Stomoxys calcitrans (stable fly): 106096045 Help Entry 106096045         CDS       T07664                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism scac  Stomoxys calcitrans (stable fly) Pathway scac03420   Nucleotide excision repair scac04120   Ubiquitin mediated proteolysis scac04141   Protein processing in endoplasmic reticulum scac04310   Wnt signaling pathway scac04341   Hedgehog signaling pathway - fly scac04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:scac00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106096045    04120 Ubiquitin mediated proteolysis     106096045   09124 Replication and repair    03420 Nucleotide excision repair     106096045  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106096045    04341 Hedgehog signaling pathway - fly     106096045    04350 TGF-beta signaling pathway     106096045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:scac04121]     106096045    03400 DNA repair and recombination proteins [BR:scac03400]     106096045 Enzymes [BR:scac01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106096045 Ubiquitin system [BR:scac04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106096045   Multi subunit type E3    SCF complex     Ring finger protein      106096045    Cul2 complex      106096045    Cul3 complex      106096045    Cul4 complex      106096045    Cul7 complex      106096045    Cul8 complex      106096045    Cul9 complex      106096045 DNA repair and recombination proteins [BR:scac03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106096045     TCR (transcription coupled repair) factors      Cul4-CSA complex       106096045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  106096045 NCBI-ProteinID:  XP_013119019 UniProt:  A0A1I8P0D4 LinkDB All DBs Position 4:89344385..89345310 Genome browser AA seq 108 aa AA seqDB search MEVDEEEFEMPSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaggtagatgaagaagagttcgagatgccctcatcgagcagcaagggtgagaaaaaa cgctttgaagtaaaaaagtggaatgctgttgctttatgggcctgggatattgttgtcgac aattgcgccatttgccgcaaccacatcatggacttatgcatcgaatgtcaagcgaaccaa gcgtctgccaccagcgaggaatgcactgtagcctggggtgtctgtaatcatgcttttcat ttccattgtatttcgcgctggttaaaaacccgccaggtctgtccattggataacagagaa tgggatttccagaaatatggccactag

DBGET integrated database retrieval system