Serinus canaria (common canary): 103816286 Help Entry 103816286         CDS       T05755                                  Symbol HYPK Name (RefSeq) huntingtin-interacting protein K   KO K28128   huntingtin-interacting protein K Organism scan  Serinus canaria (common canary) Brite KEGG Orthology (KO) [BR:scan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:scan03110]     103816286 (HYPK)    03036 Chromosome and associated proteins [BR:scan03036]     103816286 (HYPK) Chaperones and folding catalysts [BR:scan03110]  Other chaperones and cochaperones   Others    103816286 (HYPK) Chromosome and associated proteins [BR:scan03036]  Eukaryotic type   Sister chromatid cohesion proteins    Other sister chromatid cohesion factors     103816286 (HYPK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  UBA_HYPK SPT6_acidic UBA_7 T6SS_VipA Motif Other DBs NCBI-GeneID:  103816286 NCBI-ProteinID:  XP_030084344 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search VTDYAEEKEIQSSNLETAMSVIGDRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEIS RAAAERSLREHMGNVVEALITLTN NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtcacggactacgcggaggagaaggagatccagagctccaacctggagacggctatgtcg gtgatcggagaccggaggtcccgggagcagaaagccaagcaggagagggagaaagaactg gcaaaagtgaccatcaagaaggaggatctagagctgattatgacagagatggaaatatca cgggctgcagcagagcgcagcctgcgtgagcacatgggcaacgtggtggaggctctcatc accctcaccaactga

DBGET integrated database retrieval system