Serinus canaria (common canary): 103822153 Help Entry 103822153         CDS       T05755                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism scan  Serinus canaria (common canary) Pathway scan00510   N-Glycan biosynthesis scan00513   Various types of N-glycan biosynthesis scan04141   Protein processing in endoplasmic reticulum Module scan_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:scan00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     103822153 (TMEM258)    00513 Various types of N-glycan biosynthesis     103822153 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103822153 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 Phage_holin_3_3 TctB Motif Other DBs NCBI-GeneID:  103822153 NCBI-ProteinID:  XP_009095365 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMG FGVLFLLLWVGIYV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcagatacacgagcccggtgaacccggccgtgttcccgcacctcaccgtggtgctg ctggccatcggcatgttcttcaccgcctggttcttcgtctacgaggtgacgtccaccaag tacacccgggacatctacaaggagctgctgatctcgctggtggcctcgctcttcatgggc ttcggcgtcctcttcctgctgctctgggtcgggatctacgtctga

DBGET integrated database retrieval system