KEGG   Saccharomyces cerevisiae (budding yeast): YBR278W
Entry
YBR278W           CDS       T00005                                 
Symbol
DPB3
Name
(RefSeq) DNA polymerase epsilon noncatalytic subunit
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YBR278W (DPB3)
   03410 Base excision repair
    YBR278W (DPB3)
   03420 Nucleotide excision repair
    YBR278W (DPB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBR278W (DPB3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YBR278W (DPB3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YBR278W (DPB3)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    YBR278W (DPB3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      YBR278W (DPB3)
SSDB
Motif
Pfam: CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 852580
NCBI-ProteinID: NP_009837
SGD: S000000482
UniProt: P27344
Structure
LinkDB
Position
II:760294..760899
AA seq 201 aa
MSNLVKEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQLN
SKGKTSLRLSLNSIEECVEKRDNFRFLEDAIKQLKKNSALDKKRELNMQPGRSDQEVVIE
EPELHEDDGVEEEEEEDEVSEEEEPVHNEELLDDSKDQQNDKSTRSVASLLSRFQYKSAL
DVGEHSDSSDIEVDHTKSTDP
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtccaacttagttaaagaaaaagcacctgtctttcctatatctaaagtaaagaagatt
gccaaatgcgaccccgaatacgtaattacatctaatgtagctatatcagcgaccgcattc
gctgctgagttatttgtacagaatctcgtcgaagaatcgctggtcttagcacaactgaat
tcgaaaggaaagacaagcctacgattaagcctaaattctatagaagaatgtgtcgaaaaa
agagataatttcaggtttctagaggatgccattaaacaactgaagaagaatagcgcactc
gacaagaagagagaactaaacatgcaaccgggtcggagcgatcaagaggttgttatagaa
gagcctgaattgcatgaggatgatggtgtagaggaagaagaagaagaagacgaggtatcc
gaagaagaagagcccgtacacaatgaagaacttcttgatgatagtaaagatcaacaaaat
gataaatccacgcgcagtgtggcaagcttgctgtcgagattccagtataaatccgcacta
gacgtaggagaacactccgactcttctgatatcgaagttgaccatacgaaaagcaccgat
ccttag

KEGG   Saccharomyces cerevisiae (budding yeast): YDR121W
Entry
YDR121W           CDS       T00005                                 
Symbol
DPB4
Name
(RefSeq) DNA polymerase epsilon noncatalytic subunit
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YDR121W (DPB4)
   03410 Base excision repair
    YDR121W (DPB4)
   03420 Nucleotide excision repair
    YDR121W (DPB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YDR121W (DPB4)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR121W (DPB4)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR121W (DPB4)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YDR121W (DPB4)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    YDR121W (DPB4)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    YDR121W (DPB4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      YDR121W (DPB4)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone
Other DBs
NCBI-GeneID: 851699
NCBI-ProteinID: NP_010406
SGD: S000002528
UniProt: Q04603
Structure
LinkDB
Position
IV:693585..694175
AA seq 196 aa
MPPKGWRKDAQGNYPTTSYIKEQENITIQDLLFPKSTIVNLAREVPQQSGKKLLINKDAS
LALQRGATVFVNHLLLFAREIAKSQDKKSCSVDDVLSALDHIGHSALKGPVRDKLDEYQA
AVEQRKKEKLDSGEVDADGDIDMGEDKENVPVEKVKEHDEIEEQGDALQDVEESSEKKQK
TESQDVETRVQNLEQT
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccaccaaaaggttggagaaaagacgcccaagggaattaccccactacttcgtatatt
aaagaacaagagaacattacgattcaggacctgttatttcctaaaagcactattgtgaat
ttggcacgcgaagtgccacagcaaagcggcaaaaagctgctgataaataaagacgcatca
ctagcgttacagcgtggtgctacagtatttgttaaccacttgctcctgtttgcaagggaa
attgcaaagagtcaagataaaaaaagctgcagtgtagatgatgttctgagtgctttggac
catataggacactcggcattgaagggtccggttagagataaactagatgaataccaagct
gctgttgaacagaggaagaaggaaaaactagatagtggtgaagtagatgctgatggcgat
atagatatgggtgaagataaggagaatgtgcccgtggaaaaggttaaagagcatgacgaa
atagaagaacaaggcgatgcattacaggacgtagaagagtcctccgaaaagaaacagaaa
acggagagccaagatgtagaaactagagttcaaaaccttgagcaaacgtaa

KEGG   Saccharomyces cerevisiae (budding yeast): YJL065C
Entry
YJL065C           CDS       T00005                                 
Symbol
DLS1
Name
(RefSeq) Dls1p
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YJL065C (DLS1)
   03410 Base excision repair
    YJL065C (DLS1)
   03420 Nucleotide excision repair
    YJL065C (DLS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YJL065C (DLS1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJL065C (DLS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YJL065C (DLS1)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    YJL065C (DLS1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      YJL065C (DLS1)
SSDB
Motif
Pfam: CBFD_NFYB_HMF SUIM_assoc DUF4411
Other DBs
NCBI-GeneID: 853381
NCBI-ProteinID: NP_012470
SGD: S000003601
UniProt: P40366
LinkDB
Position
X:complement(315054..315557)
AA seq 167 aa
MNNETSGKETASAPLCSPKLPVEKVQRIAKNDPEYMDTSDDAFVATAFATEFFVQVLTHE
SLHRQQQQQQQQVPPLPDELTLSYDDISAAIVHSSDGHLQFLNDVIPTTKNLRLLVEENR
VRYTTSVMPPNEVYSAYVVNDTAPKPNIVEIDLDNDEDDDEDVTDQE
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaacaacgagactagtggtaaagaaacggcgtctgcacctctgtgttcgcccaagtta
cctgtagaaaaagtgcagagaatagccaagaatgatccagaatatatggacacttcggat
gacgcattcgtagccacagcgtttgctacagaattcttcgtccaggtgctgacacatgag
tccctacataggcaacagcagcagcaacaacaacaggtaccgccgctcccagatgaactc
acgctgtcgtacgatgacatctctgccgcaattgtgcactcttctgacggccatctgcag
tttttgaatgatgtgataccaacaacaaagaatttgaggcttctagtggaagaaaaccga
gttagatatactacaagtgtcatgccccctaatgaagtttactccgcctatgtggtgaac
gatacggctccgaagcccaacattgtcgagattgatcttgataatgacgaagacgacgac
gaagacgttactgatcaagaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YNL262W
Entry
YNL262W           CDS       T00005                                 
Symbol
POL2, DUN2
Name
(RefSeq) DNA polymerase epsilon catalytic subunit
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YNL262W (POL2)
   03410 Base excision repair
    YNL262W (POL2)
   03420 Nucleotide excision repair
    YNL262W (POL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL262W (POL2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YNL262W (POL2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YNL262W (POL2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    YNL262W (POL2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      YNL262W (POL2)
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 NAPRTase_C zf-DNA_Pol Cytochrom_c3_2
Other DBs
NCBI-GeneID: 855459
NCBI-ProteinID: NP_014137
SGD: S000005206
UniProt: P21951
Structure
LinkDB
Position
XIV:148212..154880
AA seq 2222 aa
MMFGKKKNNGGSSTARYSAGNKYNTLSNNYALSAQQLLNASKIDDIDSMMGFERYVPPQY
NGRFDAKDIDQIPGRVGWLTNMHATLVSQETLSSGSNGGGNSNDGERVTTNQGISGVDFY
FLDEEGGSFKSTVVYDPYFFIACNDESRVNDVEELVKKYLESCLKSLQIIRKEDLTMDNH
LLGLQKTLIKLSFVNSNQLFEARKLLRPILQDNANNNVQRNIYNVAANGSEKVDAKHLIE
DIREYDVPYHVRVSIDKDIRVGKWYKVTQQGFIEDTRKIAFADPVVMAFDIETTKPPLKF
PDSAVDQIMMISYMIDGEGFLITNREIISEDIEDFEYTPKPEYPGFFTIFNENDEVALLQ
RFFEHIRDVRPTVISTFNGDFFDWPFIHNRSKIHGLDMFDEIGFAPDAEGEYKSSYCSHM
DCFRWVKRDSYLPQGSQGLKAVTQSKLGYNPIELDPELMTPYAFEKPQHLSEYSVSDAVA
TYYLYMKYVHPFIFSLCTIIPLNPDETLRKGTGTLCEMLLMVQAYQHNILLPNKHTDPIE
RFYDGHLLESETYVGGHVESLEAGVFRSDLKNEFKIDPSAIDELLQELPEALKFSVEVEN
KSSVDKVTNFEEIKNQITQKLLELKENNIRNELPLIYHVDVASMYPNIMTTNRLQPDSIK
AERDCASCDFNRPGKTCARKLKWAWRGEFFPSKMDEYNMIKRALQNETFPNKNKFSKKKV
LTFDELSYADQVIHIKKRLTEYSRKVYHRVKVSEIVEREAIVCQRENPFYVDTVKSFRDR
RYEFKGLAKTWKGNLSKIDPSDKHARDEAKKMIVLYDSLQLAHKVILNSFYGYVMRKGSR
WYSMEMAGITCLTGATIIQMARALVERVGRPLELDTDGIWCILPKSFPETYFFTLENGKK
LYLSYPCSMLNYRVHQKFTNHQYQELKDPLNYIYETHSENTIFFEVDGPYKAMILPSSKE
EGKGIKKRYAVFNEDGSLAELKGFELKRRGELQLIKNFQSDIFKVFLEGDTLEGCYSAVA
SVCNRWLDVLDSHGLMLEDEDLVSLICENRSMSKTLKEYEGQKSTSITTARRLGDFLGED
MVKDKGLQCKYIISSKPFNAPVTERAIPVAIFSADIPIKRSFLRRWTLDPSLEDLDIRTI
IDWGYYRERLGSAIQKIITIPAALQGVSNPVPRVEHPDWLKRKIATKEDKFKQTSLTKFF
SKTKNVPTMGKIKDIEDLFEPTVEEDNAKIKIARTTKKKAVSKRKRNQLTNEEDPLVLPS
EIPSMDEDYVGWLNYQKIKWKIQARDRKRRDQLFGNTNSSRERSALGSMIRKQAESYANS
TWEVLQYKDSGEPGVLEVFVTINGKVQNITFHIPKTIYMKFKSQTMPLQKIKNCLIEKSS
ASLPNNPKTSNPAGGQLFKITLPESVFLEEKENCTSIFNDENVLGVFEGTITPHQRAIMD
LGASVTFRSKAMGALGKGIQQGFEMKDLSMAENERYLSGFSMDIGYLLHFPTSIGYEFFS
LFKSWGDTITILVLKPSNQAQEINASSLGQIYKQMFEKKKGKIETYSYLVDIKEDINFEF
VYFTDISKLYRRLSQETTKLKEERGLQFLLLLQSPFITKLLGTIRLLNQMPIVKLSLNEV
LLPQLNWQPTLLKKLVNHVLSSGSWISHLIKLSQYSNIPICNLRLDSMDYIIDVLYARKL
KKENIVLWWNEKAPLPDHGGIQNDFDLNTSWIMNDSEFPKINNSGVYDNVVLDVGVDNLT
VNTILTSALINDAEGSDLVNNNMGIDDKDAVINSPSEFVHDAFSNDALNVLRGMLKEWWD
EALKENSTADLLVNSLASWVQNPNAKLFDGLLRYHVHNLTKKALLQLVNEFSALGSTIVY
ADRNQILIKTNKYSPENCYAYSQYMMKAVRTNPMFSYLDLNIKRYWDLLIWMDKFNFSGL
ACIEIEEKENQDYTAVSQWQLKKFLSPIYQPEFEDWMMIILDSMLKTKQSYLKLNSGTQR
PTQIVNVKKQDKEDSVENSLNGFSHLFSKPLMKRVKKLFKNQQEFILDPQYEADYVIPVL
PGSHLNVKNPLLELVKSLCHVMLLSKSTILEIRTLRKELLKIFELREFAKVAEFKDPSLS
LVVPDFLCEYCFFISDIDFCKAAPESIFSCVRCHKAFNQVLLQEHLIQKLRSDIESYLIQ
DLRCSRCHKVKRDYMSAHCPCAGAWEGTLPRESIVQKLNVFKQVAKYYGFDILLSCIADL
TI
NT seq 6669 nt   +upstreamnt  +downstreamnt
atgatgtttggcaagaaaaaaaacaacggaggatcttccactgcaagatattcagctggc
aacaagtacaacacactctcaaataattatgcgcttagcgcgcaacagctcttaaatgct
agtaagatcgatgacatcgattcgatgatgggatttgaaagatacgtaccgccgcaatac
aatggcaggtttgatgcgaaggatatagatcagattccaggccgcgtagggtggctgacg
aacatgcacgcaacgctggtctctcaggaaaccttatccagtggtagtaatggcggcggc
aattcgaatgacggagaacgtgtaacgaccaaccaaggtatttccggagttgacttctac
tttttagatgaagagggtgggagcttcaagtcgacagttgtctatgacccatacttcttt
attgcgtgtaacgatgaatcaagagtaaatgatgtggaggaactagtgaaaaaatatctg
gaatcttgtctcaaaagcttacaaatcattagaaaggaagatcttaccatggacaatcac
cttttagggctgcagaagacacttattaagttatcatttgtaaattccaatcagttattc
gaggccaggaaactcctgaggccaatcttgcaggataatgccaataataatgtgcaaaga
aatatatataacgttgctgcaaatggctcggaaaaagttgacgccaaacatctgatcgaa
gatatcagggaatatgatgtgccgtatcatgtccgagtatctatagacaaggacattaga
gtcggtaaatggtataaggtaactcaacagggattcattgaagatactaggaaaattgca
tttgccgaccctgtggtaatggcatttgatatagaaaccacgaagccgcctttaaaattc
ccggattccgccgtagatcaaataatgatgatttcgtatatgatcgatggggaaggtttt
ttgataacaaatagggagataatctctgaggatattgaagactttgagtatacaccgaaa
ccggagtatcctggttttttcaccatatttaacgaaaacgatgaagtggcgcttctacaa
aggttttttgaacatataagagatgtacgacccactgttatatccaccttcaatggtgac
tttttcgattggccttttatacataacagaagtaagattcacggcttggacatgttcgat
gaaattggtttcgctccagatgctgaaggtgagtacaagtcctcatactgctctcacatg
gattgtttccgttgggtgaagcgtgattcttatttaccacaaggttcccagggtttaaaa
gctgttactcaatctaagctaggttataacccaattgaactggatcccgaattaatgacg
ccgtatgcatttgaaaagccacagcacctttccgaatattctgtttccgatgcagtcgct
acgtattacctttacatgaaatatgttcatccttttatcttttccctttgtactattatt
cctttgaacccggatgaaacattgagaaagggtaccggtactttgtgtgaaatgttgttg
atggttcaagcttatcaacataatattcttctaccaaataagcatacagatcccattgag
aggttctatgatggacatcttctagaatccgagacttacgtgggtggacatgtggagtca
ttagaagctggtgtttttaggagtgatttgaagaatgaattcaagatagatccttctgcc
attgatgaattattacaagaattaccagaagctttgaaatttagtgtggaagttgaaaat
aagtccagtgtagataaagtaacgaattttgaggaaataaaaaaccagataacgcagaaa
ttattagagttgaaggaaaacaatataagaaacgaactacctttgatctatcatgtagat
gtcgcctctatgtacccaaacatcatgactacaaatagactacaaccagatagtatcaaa
gcagagcgcgattgtgctagttgcgattttaatagacccggaaaaacctgtgcaagaaag
ttaaaatgggcttggagaggagaattctttcccagtaagatggatgagtataacatgatc
aagcgtgcattacaaaatgagacttttcccaacaaaaacaagttttctaaaaagaaagtt
ttgacatttgatgaactaagttacgcagaccaagttatccacataaaaaaacgtttaact
gaatattcaaggaaagtttatcatagggttaaagtatcagaaattgtcgaacgagaagcc
attgtctgccaaagagaaaatccattctacgtcgataccgtgaaatcctttcgtgatagg
cgttacgaattcaaaggtttagccaagacttggaagggaaatctgtccaaaattgaccca
tctgataagcatgcgagagacgaggccaaaaagatgattgtgctttatgactcattacaa
ttagctcacaaagttattttgaattcgttttatgggtatgttatgaggaaaggctctcgt
tggtattccatggaaatggcggggattacgtgtttaacaggtgccacgatcattcaaatg
gcgagagctttagtagaaagggtaggaagaccattagaattagatactgatggtatttgg
tgtatcttaccaaaatctttccctgaaacttacttttttacattagaaaatggtaaaaag
ctttatctctcctacccatgttccatgctgaattacagagttcaccaaaagtttacgaat
caccaataccaagaattaaaagacccattgaactatatatatgagacgcacagtgaaaac
acgatttttttcgaagttgacggaccatataaggccatgattttgcctagttccaaggaa
gaaggaaaaggtataaagaaaagatatgctgtcttcaatgaagacggctcacttgctgaa
ctgaaaggttttgaattgaagaggcgtggtgaattacaactaataaaaaattttcaaagt
gatattttcaaggtctttttggaaggtgatacattagaaggatgttacagtgctgtagca
agcgtatgtaaccgttggttagatgttcttgattcacatggtcttatgttagaagatgaa
gacttggtcagtttgatttgtgaaaatagaagtatgtcaaaaactttaaaggaatatgaa
gggcaaaaatctacttctattacgacggcaaggagattgggggattttttgggtgaagat
atggtaaaagataaaggtctacaatgtaaatatattattagttcaaaacctttcaatgca
cctgttactgaacgagccattccagtcgcaatattttcagcggacattcccatcaaaagg
tcttttctgaggcgatggacattagatccatctttggaagatctggatatcagaaccata
atcgattggggttattatagagaaagacttggatctgctatacaaaagataattactatt
ccagcagcattacaaggggtttccaatcctgttccaagggttgaacatccagattggcta
aaaagaaaaatcgctacaaaggaggataagtttaagcagacttcactaaccaaatttttt
tcgaagacaaagaatgtaccaacaatgggcaagataaaagatatcgaggatttgtttgaa
ccaactgtagaagaagataacgccaaaattaaaattgcaagaactactaaaaagaaagcc
gtatccaagaggaaaagaaatcagcttacaaatgaagaagatccactagtattgccctcg
gagattccttccatggacgaggactatgttgggtggctaaattatcaaaaaattaaatgg
aaaatccaagcaagagatagaaagcgtcgagaccaattatttggtaatacaaacagctcc
cgtgaaagaagtgcactaggaagtatgattaggaagcaagctgaatcatatgcgaactcc
acttgggaggtcttacaatacaaggattccggtgagccaggggttttggaagtatttgta
acaattaatggcaaagtccagaacatcaccttccatataccaaaaactatttatatgaaa
ttcaaatctcaaacaatgccgctacaaaagattaagaattgccttattgaaaaatcttct
gcatcgttaccaaataatcccaaaacgtctaatccagcaggcggtcagctattcaaaatt
actctaccggaatctgtctttctggaagaaaaggaaaactgcactagtatcttcaacgat
gaaaatgtacttggtgtatttgagggcactatcactcctcatcaaagagcgatcatggat
ttgggagcttcggtaacgttccgctcaaaagcaatgggtgcgttaggcaagggaatacag
cagggttttgaaatgaaggatctttcaatggcggaaaatgaaaggtatctgagtggattt
tcaatggacattggctatttactacatttcccaacatcaattgggtatgaatttttttca
ttattcaagtcatggggagatactattactatattagttttgaaaccatccaaccaggct
caggaaataaatgcctcatcattaggacaaatatacaaacaaatgtttgaaaaaaagaaa
ggtaaaatagaaacatattcttacttggttgatattaaagaagatatcaattttgagttt
gtatattttacagatatctcaaaattgtacagaagactatcacaggaaactactaaatta
aaagaagaaagaggtctgcagtttttactcttgttacaatctccgtttatcactaagctc
ttaggcacaatccggcttctaaaccagatgcccattgttaagctttccttgaatgaagtt
cttctaccccaattgaactggcaaccgacattattgaagaaacttgttaaccacgtttta
tccagtggttcgtggatttctcacttgatcaagttatcccagtatagtaacattccaatc
tgtaatttgaggctggatagtatggattatattattgatgttctttatgcaagaaaacta
aaaaaagagaacatcgtgctttggtggaatgagaaagctccacttccagatcatggaggc
attcaaaatgattttgatttaaatacatcatggataatgaatgattcagaatttcccaaa
attaataactcaggtgtgtatgacaatgtagttctcgatgttggtgttgataatttaaca
gtgaacacaattttgacatcagcattaatcaatgatgctgaaggcagtgatctagttaac
aataatatgggtatagatgacaaagatgccgttattaactcgccatctgaattcgtgcac
gacgccttttctaatgacgctttgaatgttttaagaggtatgttaaaggagtggtgggat
gaggccctaaaagaaaattcaaccgcagatttgttggtaaattccctggcaagttgggtt
caaaacccgaatgcgaaactattcgacggattactaagatatcacgttcataacttaaca
aaaaaagccttacttcaattagtaaatgaatttagtgcacttggctcaactattgtatat
gcagacaggaatcaaattctaataaagacaaacaagtactcacctgaaaactgttacgcc
tacagccaatatatgatgaaggcagttagaacaaatccaatgtttagttatctggactta
aatatcaaacgttattgggatctgctaatatggatggataagtttaattttagtggatta
gcatgtattgaaatagaggaaaaggaaaatcaggattataccgctgtttcgcaatggcaa
ctaaagaagtttctgtcaccaatatatcagcccgaatttgaggattggatgatgatcata
ttggatagtatgctaaagacaaagcagagctatctaaaattgaattcagggacgcaaaga
cctacccaaatagttaatgtaaaaaaacaagataaggaagatagtgttgaaaactcgttg
aacggattttctcaccttttttccaaaccactaatgaaaagagtcaaaaagctttttaaa
aaccagcaagagttcattttagatcctcagtatgaggcagactatgttattcctgttctt
cctggttcccatctgaatgtgaaaaatccccttctagaacttgtcaaatcactctgccat
gtcatgttactttcaaagagtacaattttagaaatcaggaccctgagaaaagaactgctg
aagatatttgaattgcgtgagtttgctaaagtagcggaattcaaagatccaagtttgagt
ctcgtggtgccggattttttatgtgaatactgttttttcatttctgatattgacttttgt
aaggcagctcctgaatctattttttcatgcgtcagatgtcacaaagcctttaatcaagta
ttgttgcaagaacacctgattcaaaaactacgttctgatatcgaatcctatttaattcaa
gatttgagatgctccagatgtcataaagtgaaacgtgactatatgagtgcccactgtcca
tgtgccggcgcgtgggaaggaactctccccagagaaagcattgttcaaaagttaaatgtg
tttaagcaagtagccaagtattacggttttgatatattattgagttgtattgctgatttg
accatatga

KEGG   Saccharomyces cerevisiae (budding yeast): YPR175W
Entry
YPR175W           CDS       T00005                                 
Symbol
DPB2
Name
(RefSeq) DNA polymerase epsilon noncatalytic subunit
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YPR175W (DPB2)
   03410 Base excision repair
    YPR175W (DPB2)
   03420 Nucleotide excision repair
    YPR175W (DPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YPR175W (DPB2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YPR175W (DPB2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YPR175W (DPB2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    YPR175W (DPB2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      YPR175W (DPB2)
SSDB
Motif
Pfam: DNA_pol_E_B
Other DBs
NCBI-GeneID: 856305
NCBI-ProteinID: NP_015501
SGD: S000006379
UniProt: P24482
Structure
LinkDB
Position
XVI:888974..891043
AA seq 689 aa
MFGSGNVLPVKIQPPLLRPLAYRVLSRKYGLSIKSDGLSALAEFVGTNIGANWRQGPATI
KFLEQFAAVWKQQERGLFIDQSGVKEVIQEMKEREKVEWSHEHPIQHEENILGRTDDDEN
NSDDEMPIAADSSLQNVSLSSPMRQPTERDEYKQPFKPESSKALDWRDYFKVINASQQQR
FSYNPHKMQFIFVPNKKQNGLGGIAGFLPDIEDKVQMFLTRYYLTNDRVMRNENFQNSDM
FNPLSSMVSLQNELSNTNRQQQSSSMSITPIKNLLGRDAQNFLLLGLLNKNFKGNWSLED
PSGSVEIDISQTIPTQGHYYVPGCMVLVEGIYYSVGNKFHVTSMTLPPGERREITLETIG
NLDLLGIHGISNNNFIARLDKDLKIRLHLLEKELTDHKFVILGANLFLDDLKIMTALSKI
LQKLNDDPPTLLIWQGSFTSVPVFASMSSRNISSSTQFKNNFDALATLLSRFDNLTENTT
MIFIPGPNDLWGSMVSLGASGTLPQDPIPSAFTKKINKVCKNVVWSSNPTRIAYLSQEIV
IFRDDLSGRFKRHRLEFPFNESEDVYTENDNMMSKDTDIVPIDELVKEPDQLPQKVQETR
KLVKTILDQGHLSPFLDSLRPISWDLDHTLTLCPIPSTMVLCDTTSAQFDLTYNGCKVIN
PGSFIHNRRARYMEYVPSSKKTIQEEIYI
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgtttggctctgggaatgttctgcctgttaaaattcagcctccgctgcttaggccactg
gcgtatagagttttatcaagaaaatatggtttatcaattaaatctgatggactgtctgct
cttgcagaattcgttggcactaatataggtgctaactggagacaagggcctgctacaata
aaatttctcgagcaatttgctgcagtatggaaacaacaagaaagaggccttttcatcgac
cagagcggggttaaagaagttatacaggagatgaaagaacgtgagaaagtcgaatggagt
catgaacaccctattcaacatgaggagaatatcttgggacggacagatgacgatgagaac
aacagtgacgatgaaatgccgatcgctgctgattcatccttacaaaatgtttcattatct
tcacccatgcgacagcccaccgaaagagatgaatataaacagcctttcaagccagaaagc
tccaaggcgttggactggagggactacttcaaagttatcaatgcttctcagcaacaaaga
ttctcatacaatccgcacaaaatgcaatttattttcgtccccaataaaaagcagaatggg
ctaggaggcattgcgggttttctaccagatatagaggacaaagttcaaatgttcttgaca
agatattacctcacgaacgacagagtcatgagaaatgaaaacttccaaaacagtgacatg
tttaatccattatcatctatggtgtctttacaaaatgaactgtccaatactaaccgacag
cagcaatccagcagtatgagtatcaccccaataaaaaacctactaggtagggatgctcaa
aactttctactattggggctcttaaataagaactttaagggcaattggtcactggaagat
ccgtctggatctgtcgaaattgacatttcccaaactatccctacacaaggccattactac
gtgccaggttgcatggttcttgtggaaggaatatactattctgtaggaaataaattccat
gttacctccatgactttaccccctggtgagagaagagaaattacattagaaacgataggt
aatctcgatctcttaggaatacatggcatttctaataacaatttcattgctcgtttggat
aaagatttgaagattagattacaccttttggagaaagaattaacagatcataaatttgta
attctcggcgcaaatttgttcctagatgatttgaaaattatgactgcactcagcaaaatt
ttgcaaaaattaaatgatgacccaccgaccctattaatttggcaaggttctttcacttca
gttcccgttttcgcatcaatgagtagccggaatataagtagttccactcaatttaagaat
aatttcgatgccttggcgacgcttctgtcaagatttgacaatttgaccgaaaataccaca
atgatatttattccaggtcctaacgatttatgggggtcgatggtgtcattgggggcaagt
gggacattaccgcaagatccaattcctagtgcgtttaccaaaaaaatcaacaaggtctgt
aaaaacgttgtatggagctcaaatccaactagaatagcatacttatcccaagaaatagtc
attttcagggacgatttatccggaagattcaaaagacaccgtttggaattcccattcaac
gagagcgaagatgtttatactgaaaacgataacatgatgtctaaagacaccgatattgta
ccaatcgatgaattagttaaagaaccagaccagttaccacaaaaggttcaagaaacaaga
aaactcgttaaaacaatactagaccagggtcatttatcgccatttcttgattccttgcgc
ccaatttcatgggatttggaccacactttgacactttgcccaataccatcgacaatggtt
ctttgcgacactacttctgcacaatttgatttgacatacaacggttgtaaagtaattaac
cctggaagtttcattcataatagacgtgctaggtatatggagtacgttccatcctcaaag
aaaactatacaagaagagatatatatctaa

DBGET integrated database retrieval system