KEGG   Saccharomyces cerevisiae (budding yeast): YDL132W
Entry
YDL132W           CDS       T00005                                 
Symbol
CDC53
Name
(RefSeq) cullin CDC53
  KO
K03347  cullin 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDL132W (CDC53)
   04120 Ubiquitin mediated proteolysis
    YDL132W (CDC53)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL132W (CDC53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDL132W (CDC53)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     YDL132W (CDC53)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Penicillinase_R
Other DBs
NCBI-GeneID: 851424
NCBI-ProteinID: NP_010150
SGD: S000002290
UniProt: Q12018
Structure
LinkDB
Position
IV:224304..226751
AA seq 815 aa
MSETLPRSDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCV
NKSRSSGHFSTDSRTGQSTILVGSEIYEKLKNYLKNYILNFKQSNSETFLQFYVKRWKRF
TIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKEVMFDPSKDVLINELLDQ
VTLGREGQIIQRSNISTAIKSLVALGIDPQDLKKLNLNVYIQVFEKPFLKKTQEYYTQYT
NDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDHTKKPLSMALNKVLITDHIEKLENEFV
VLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTGENEISSLLAMHKHNIMKNEN
ANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDIPLAKALDNACGAFININE
FALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSDEDIITIFKYLTDKDAFETH
YRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTGKITKMFQDIRLSKILEDDFAVAL
KNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILK
WLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSLTIQHIA
AAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVKNDILQSLSGGG
HDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQ
RFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgtctgagactctgcctagatctgatgatttagaggccacttggaactttatagagcca
ggaattaaccaaatactgggtaatgagaaaaaccaagcatccacgtctaagcgagtttac
aaaattctttctccaaccatgtatatggaagtctataccgcaatttataactactgtgtg
aacaaatcacgctcgtctggacattttagtactgacagtagaactggccaatcaacaatt
ttggttggcagtgagatttacgaaaagttaaagaattatttgaagaattacattttaaat
tttaagcagtctaattcagagacctttttgcagttttacgtcaagcgctggaaaaggttt
acaataggtgccatttttttaaaccatgcattcgattatatgaatagatattgggttcaa
aaggaaagaagtgacggcaaaaggcatatttttgatgtaaacaccttgtgcttgatgaca
tggaaagaagtcatgtttgatccgagtaaagatgttttaataaacgaattattagaccag
gtaaccttgggaagggaggggcaaataattcaaagaagtaatattagcactgccataaag
tctttagttgcactaggtatcgatccacaggatttgaaaaagttgaacctaaatgtctac
atccaagttttcgaaaagccatttttaaagaagactcaggagtactacacgcaatataca
aacgattatttagagaaacactcggtaactgagtatatttttgaagcacatgaaatcatc
aaacgtgaggaaaaagcaatgacaatatattgggatgatcatacaaaaaaaccactatcc
atggcattaaacaaggtcttgatcacagaccatattgaaaagttggaaaatgagtttgtt
gtccttctggatgccagagatattgaaaaaattacttctttgtacgcactaatacgcaga
gactttacattaatcccaagaatggcttcagtgtttgaaaattatgttaaaaagacaggt
gagaatgaaatttcgagtctactggcaatgcataaacacaatattatgaaaaacgaaaac
gcaaaccctaaaaaactagcactaatgacagctcactccctttctcctaaagactatatc
aagaaattactggaagtacacgatatattctctaagatttttaatgaaagtttccccgac
gacatacctttagctaaagctctagataatgcgtgtggtgctttcatcaacatcaacgag
ttcgcattacctgctggatctccaaaaagtgccacctcgaagacttccgagatgctagct
aagtacagtgatatactattaaagaaggccaccaaacctgaagtggcaagtgacatgtca
gatgaagatattataacaatattcaaatatttgaccgacaaagatgcgttcgaaactcat
tatagaagacttttcgccaagcgtttaattcatggcacttcaacatcagcagaagacgaa
gaaaatattattcaaaggctgcaagcggcaaatagtatggaatatacaggcaagataact
aaaatgtttcaagatattagactttccaagatcttggaagacgattttgctgtcgccctg
aagaatgaaccagattactctaaagcaaaatatccagatctacaaccatttgtattggca
gaaaatatgtggccattttcataccaagaagttgaatttaagctacccaaggaattggta
ccatctcacgaaaaattgaaggagtcatacagccaaaagcataatggtagaatattgaag
tggctatggccattatgtcgtggcgaattgaaggcagatattggaaaacccggcaggatg
ccgttcaactttacggtaacactgtttcaaatggcaattttgctactatataacgatgct
gatgtattaaccttagaaaatattcaagagggcacgagcttaaccattcagcacatcgca
gcggcaatggtaccattcatcaaattcaaactgattcaacaggtcccaccagggctagat
gctctcgtgaaacctgaaacacaattcaagctatcacgtccttataaggcgcttaagacc
aatattaatttcgctagcggagtcaaaaacgacattctgcaatcgctatccggtggaggc
cacgataatcacggtaataagttaggaaacaaacgcttgacggaagacgaaagaatagaa
aaagaattgaatacagaaaggcagattttcttggaagcttgtattgtgagaataatgaaa
gcgaaaagaaatctgccacatacaacattggtcaacgaatgcattgcgcaatcacaccaa
aggttcaatgcaaaggtttctatggtcaagagagccatcgatagcttaatacaaaaggga
tacctacagaggggagacgatggtgaatcgtatgcttaccttgcttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YDR328C
Entry
YDR328C           CDS       T00005                                 
Symbol
SKP1, MGO1
Name
(RefSeq) SCF ubiquitin ligase subunit SKP1
  KO
K03094  S-phase kinase-associated protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDR328C (SKP1)
   04120 Ubiquitin mediated proteolysis
    YDR328C (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR328C (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR328C (SKP1)
   04121 Ubiquitin system [BR:sce04121]
    YDR328C (SKP1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR328C (SKP1)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    YDR328C (SKP1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     YDR328C (SKP1)
   Cul7 complex
     YDR328C (SKP1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     YDR328C (SKP1)
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YDR328C (SKP1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ rRNA_processing
Other DBs
NCBI-GeneID: 851928
NCBI-ProteinID: NP_010615
SGD: S000002736
UniProt: P52286
Structure
LinkDB
Position
IV:complement(1125434..1126018)
AA seq 194 aa
MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSK
DNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWD
REFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE
EAAIRRENEWAEDR
NT seq 585 nt   +upstreamnt  +downstreamnt
atggtgacttctaatgttgtcctagtgagtggtgagggtgaacgattcaccgtagacaag
aaaatcgcggagagatccctgctattgaaaaactatctgaacgatatgcatgacagcaac
ctacaaaacaactcagattcagaatcagattcagactcggaaacgaaccacaaaagcaaa
gacaacaataacggtgacgacgacgatgaggatgacgacgagattgtgatgcccgtgccc
aatgttcggtcttccgttttgcagaaggttatcgaatgggccgagcaccacagagactct
aacttccctgacgaagatgacgacgattccagaaagagtgctcccgtggactcatgggac
agagaattcctgaaagtggaccaagagatgctatacgaaattattctggcggcaaactac
ctcaacatcaagcccttgcttgacgctggctgcaaggtggttgctgaaatgatcagggga
aggtctcccgaggaaattagaagaacgtttaatatcgtcaacgacttcactccagaggag
gaggctgccattaggcgtgaaaatgaatgggctgaagaccgttag

KEGG   Saccharomyces cerevisiae (budding yeast): YOL133W
Entry
YOL133W           CDS       T00005                                 
Symbol
HRT1, HRT2, RBX1, ROC1
Name
(RefSeq) SCF ubiquitin ligase complex subunit HRT1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YOL133W (HRT1)
   04120 Ubiquitin mediated proteolysis
    YOL133W (HRT1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YOL133W (HRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YOL133W (HRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YOL133W (HRT1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOL133W (HRT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     YOL133W (HRT1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   YOL133W (HRT1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     YOL133W (HRT1)
   Cul2 complex
     YOL133W (HRT1)
   Cul3 complex
     YOL133W (HRT1)
   Cul4 complex
     YOL133W (HRT1)
   Cul7 complex
     YOL133W (HRT1)
   Cul9 complex
     YOL133W (HRT1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      YOL133W (HRT1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      YOL133W (HRT1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_4
Other DBs
NCBI-GeneID: 853986
NCBI-ProteinID: NP_014508
SGD: S000005493
UniProt: Q08273
LinkDB
Position
XV:70325..70690
AA seq 121 aa
MSNEVDRMDVDEDESQNIAQSSNQSAPVETKKKRFEIKKWTAVAFWSWDIAVDNCAICRN
HIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCG
R
NT seq 366 nt   +upstreamnt  +downstreamnt
atgagcaacgaagttgacaggatggatgttgatgaagatgaatcgcaaaatattgcgcaa
agctcaaaccaaagtgcgccagtggaaaccaaaaagaagagatttgaaattaagaaatgg
accgcagtggcgttttggtcatgggatatagctgttgacaactgtgctatttgcaggaac
catataatggaaccatgcattgaatgccagccaaaggccatgacggacactgataatgaa
tgtgtagcagcctggggtgtctgtaatcacgctttccatttgcactgtattaataaatgg
atcaagacaagagacgcatgcccattagataaccaaccttggcagttagcaagatgcggt
aggtga

DBGET integrated database retrieval system