KEGG   Saccharomyces cerevisiae (budding yeast): YOR005C
Entry
YOR005C           CDS       T00005                                 
Symbol
DNL4, LIG4
Name
(RefSeq) DNA ligase (ATP) DNL4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YOR005C (DNL4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOR005C (DNL4)
Enzymes [BR:sce01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     YOR005C (DNL4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     YOR005C (DNL4)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT BRCT_2 RNA_ligase DNA_ligase_A_C Fve
Other DBs
NCBI-GeneID: 854166
NCBI-ProteinID: NP_014647
SGD: S000005531
UniProt: Q08387
Structure
LinkDB
Position
XV:complement(334509..337343)
AA seq 944 aa
MISALDSIPEPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEM
WRKTVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVG
KGGNLSSLLVEEIAKRRAEPSSKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHC
VENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVR
LKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIK
FFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGS
AKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRS
SRCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLI
VIGRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSI
ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD
NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLI
RKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGG
KLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYC
FNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFL
FSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHE
KIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVVNY
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgatatcagcactagattctatacccgagccccaaaactttgcgcctagtccagatttc
aaatggctttgtgaagagctatttgtgaagatacatgaagttcaaattaatggaacggcc
ggcactggcaaatcaaggtctttcaagtactatgaaataatatcgaatttcgtcgaaatg
tggagaaaaaccgtgggaaataatatatatcctgcactggttcttgctcttccctaccgc
gatagacgaatctataatattaaggattatgtattaataagaactatatgctcttacttg
aagttgccaaaaaattctgcaacagagcagcggttaaaagattggaaacagcgtgtcggt
aaaggtgggaatctttcttctcttcttgtggaagaaattgctaaaagaagggctgaacct
agctcaaaagcgattacaattgataacgtcaatcactatctggatagtttgagtggagac
aggttcgcttccggacgaggatttaagagtcttgtcaagtccaaacctttcctgcactgt
gtggagaatatgagtttcgtcgaattaaaatacttctttgatatcgtgcttaaaaataga
gtaataggaggtcaagagcacaaattgctaaactgctggcatcctgatgctcaggattat
cttagcgtgatatctgatttaaaggtggtaacttcaaaactttatgatccaaaagttcgt
ctaaaggatgatgatttgagtataaaagttggctttgcattcgccccccaattagccaaa
aaagtgaatctttcttatgagaaaatatgccgtacactacatgatgattttttggtagaa
gaaaaaatggatggagaacgaattcaagttcattatatgaattatggtgaatccataaaa
ttttttagtagacggggcatcgactatacctatttgtacggagcgagcttatcatcagga
actatatctcaacatttgaggtttacagatagtgttaaagaatgtgttttagatggagaa
atggtgacgtttgatgcaaaaagacgggtgattcttccattcggtcttgttaaaggaagt
gcaaaggaagcgctatcttttaatagtataaataatgttgactttcaccccttatatatg
gtgtttgatctgttatacctgaatgggacttcgttgacaccattaccccttcatcaaagg
aagcaatatctgaacagcattttaagtcccttgaaaaatattgtagaaatagtacgatct
tctagatgttatggtgtggagtcaatcaaaaagtctttagaagttgcaatctcactgggt
tcagaaggagttgttttgaaatattataattcaagttataatgtcgccagtcgaaacaac
aactggatcaaggtaaaacctgaatatttggaggaatttggagagaatttagacttaata
gtaataggcagagattctgggaaaaaagattcttttatgctagggttacttgtgctagat
gaagaagagtataaaaagcaccaaggagactcctctgaaattgtagaccactcaagccaa
gaaaaacacatacaaaattcaagaagaagggtgaaaaaaatactttcattctgttctatc
gcaaacggtatatctcaagaagaattcaaagaaatcgaccgcaaaacgagaggacattgg
aaaagaacctccgaagttgctccccctgcttcaattttagaatttggctcaaaaatacct
gccgaatggattgaccccagtgaatcaattgttctagaaataaaatcacggtctttggat
aacacagaaacgaatatgcagaagtacgctaccaattgtactttgtacggtggctattgt
aaaagaatacggtacgataaagaatggacagattgttacacacttaacgacttatacgaa
agtaggacggttaaatctaaccccagctatcaagcggaaaggtcacagcttggattgata
cggaaaaagagaaagagagtacttatttcagacagctttcaccaaaacaggaaacaactg
ccaatttcaaacatctttgccggattacttttttatgttctctctgactatgtcacggag
gacactggaatacggattacacgggcagaacttgaaaaaactattgtggaacatggtggt
aaactgatatataatgtaattttaaaacgtcattcaattggggacgttcggttaatcagc
tgtaaaactaccacggaatgcaaggctttaatagatcgaggatatgatatattgcaccca
aattgggtactcgattgtatagcatataagaggctcatcctgatcgagcccaattattgc
tttaacgtctctcaaaaaatgagagccgtcgctgaaaaaagggtagattgtttgggtgat
agttttgaaaatgacatttcggaaaccaaactgtcatcattgtataaatcacaactaagt
ctaccaccgatgggggaactcgagatagattctgaggttcggcggtttccattattttta
ttctccaacaggattgcatacgtaccacgtcgcaaaattagcacagaagatgacattata
gaaatgaaaattaagttgtttggtggaaaaataacagatcaacagtcactttgtaactta
ataattataccatatactgatcctattttgaggaaagactgcatgaatgaggtacacgaa
aaaataaaagaacaaataaaggcttctgatactataccgaaaatagccagggtcgttgcc
cctgaatgggtggatcattctattaatgaaaactgtcaagtgcctgaagaagacttcccc
gtagtcaactactga

DBGET integrated database retrieval system