Siniperca chuatsi (mandarin fish): 122878011 Help Entry 122878011         CDS       T08948                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism schu  Siniperca chuatsi (mandarin fish) Pathway schu03030   DNA replication schu03410   Base excision repair schu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:schu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     122878011 (pole4)    03410 Base excision repair     122878011 (pole4)    03420 Nucleotide excision repair     122878011 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:schu03032]     122878011 (pole4)    03400 DNA repair and recombination proteins [BR:schu03400]     122878011 (pole4) Enzymes [BR:schu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      122878011 (pole4) DNA replication proteins [BR:schu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     122878011 (pole4) DNA repair and recombination proteins [BR:schu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       122878011 (pole4) SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  122878011 NCBI-ProteinID:  XP_044056231 LinkDB All DBs Position LG6:17788200..17792334 Genome browser AA seq 160 aa AA seqDB search MLLSSCVTCSEKTVVICVFCLKYNVCVINRRMAATVATPVTPTEHDPDRCGSEEESRGAE AEEESSQQQTGPAAAVTHSRPSKLPLSRIKALMKTDPDVSLASQESVFIIAKATELFVEM IAKDALVYAQQGKRKTLQRKDLDNAIEAIDEFAFLEGTLD NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgttgttgtcatcatgtgtgacatgtagcgagaagacggtagtgatttgtgtgttttgt ttgaaatataacgtttgtgtgataaaccggagaatggcagcaacagtggctacacctgtc acccccacggagcacgaccctgaccgctgtgggagtgaggaggagagccgcggggccgag gcggaggaggagagcagccagcagcagacaggccccgctgccgccgtgacgcacagccga ccgtctaaactcccgctgtcccgcataaaggcgctcatgaagaccgacccagacgtgtca ctcgccagccaggagtctgtgttcatcatcgctaaagctacggagttgtttgttgagatg attgccaaagatgccctggtgtacgcccagcaagggaagaggaaaactttgcaaagaaaa gacttggacaacgcaatagaggccatagatgaatttgcatttcttgaaggtacgctagac taa

DBGET integrated database retrieval system