Shewanella cyperi: JYB88_03215 Help Entry JYB88_03215       CDS       T07829                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism scyp  Shewanella cyperi Pathway scyp00670   One carbon pool by folate scyp00790   Folate biosynthesis scyp01100   Metabolic pathways scyp01240   Biosynthesis of cofactors scyp04981   Folate transport and metabolism Module scyp_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:scyp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     JYB88_03215 (folA)    00670 One carbon pool by folate     JYB88_03215 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     JYB88_03215 (folA) Enzymes [BR:scyp01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      JYB88_03215 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QSX30685 UniProt:  A0A974XLN9 LinkDB All DBs Position 778606..779088 Genome browser AA seq 160 aa AA seqDB search MRIAMIAAMANNRVIGKDNQMPWHLPEDLKHFKAMTLGKPVVMGRKTFESIGRPLPGRHN IVISRNTDYRPEGVSVVTSFEAAKHLVADCEELVVIGGGQLYQSLLSQADRLYLTEIALD VAGDTHFPAWDDGSWELLEKSEHIAASGIEYRFITLAKKC NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgctatgatagccgcgatggccaacaatcgcgtcataggaaaagacaaccaa atgccctggcatttgcctgaggatctcaaacatttcaaggccatgaccctgggaaagccc gtggtcatggggcgtaaaacctttgaatccataggtcgaccattgcccggcaggcacaat atcgtcatcagtcgcaataccgactatcgcccagaaggggtgagcgttgtcacttctttt gaggctgcaaaacacttggtggctgattgtgaggaactggtggtcataggcggagggcaa ctgtatcagagtcttcttagccaagccgataggctatatttaacagagattgccttggac gtggctggtgacacccatttccctgcctgggatgacggttcctgggagctgttggaaaag agtgagcacattgccgcatcgggtattgaatatcgctttatcacattggcaaaaaagtgt taa

DBGET integrated database retrieval system