Stegodyphus dumicola: 118179282 Help Entry 118179282         CDS       T07385                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism sdm  Stegodyphus dumicola Pathway sdm04517   IgSF CAM signaling Brite KEGG Orthology (KO) [BR:sdm00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     118179282  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdm04147]     118179282    04031 GTP-binding proteins [BR:sdm04031]     118179282 Exosome [BR:sdm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118179282   Exosomal proteins of other body fluids (saliva and urine)    118179282   Exosomal proteins of colorectal cancer cells    118179282 GTP-binding proteins [BR:sdm04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     118179282 SSDB OrthologParalogGFIT Motif Pfam:  Ras GTP_EFTU Herpes_LAMP2 Motif Other DBs NCBI-GeneID:  118179282 NCBI-ProteinID:  XP_035204360 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search SRVPVILVGNKTDLEEERQVTPQMVQDALKDQSKVCKYLETSAKYNVNVARLFIELLEHA RELEQPPPAPQQSRRLSRRLSSLGNINLAVRRKSSLPKVTEAKVDVPRSEPRCVIV NT seq 353 nt NT seq  +upstreamnt  +downstreamnt gtagcagagtacctgttattcttgttggcaacaagaccgatttagaagaagagcgccagg tgacacctcaaatggttcaagatgctctcaaagatcaatctaaagtttgcaaatacctgg agaccagcgccaaatacaacgttaatgttgctcgactatttatcgagctgttggaacatg cgcgagagcttgaacaacctcctcctgcgcctcagcaatccagaagactgagtcggaggc tcagttctttgggaaatattaatttggcggtccgaagaaagtccagtttgccgaaagtaa ccgaagcgaaagttgatgttccacgatctgaaccaaggtgcgttatagtttag

DBGET integrated database retrieval system