Seriola dumerili (greater amberjack): 111230345 Help Entry 111230345         CDS       T05606                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu03420   Nucleotide excision repair sdu04110   Cell cycle sdu04114   Oocyte meiosis sdu04120   Ubiquitin mediated proteolysis sdu04141   Protein processing in endoplasmic reticulum sdu04310   Wnt signaling pathway sdu04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sdu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111230345 (rbx1)    04120 Ubiquitin mediated proteolysis     111230345 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     111230345 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111230345 (rbx1)    04350 TGF-beta signaling pathway     111230345 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     111230345 (rbx1)    04114 Oocyte meiosis     111230345 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sdu04121]     111230345 (rbx1)    03400 DNA repair and recombination proteins [BR:sdu03400]     111230345 (rbx1) Enzymes [BR:sdu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111230345 (rbx1) Ubiquitin system [BR:sdu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111230345 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      111230345 (rbx1)    Cul2 complex      111230345 (rbx1)    Cul3 complex      111230345 (rbx1)    Cul4 complex      111230345 (rbx1)    Cul7 complex      111230345 (rbx1)    Cul8 complex      111230345 (rbx1)    Cul9 complex      111230345 (rbx1) DNA repair and recombination proteins [BR:sdu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111230345 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       111230345 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  111230345 NCBI-ProteinID:  XP_022612761 UniProt:  A0A3B4T222 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgtagatacaccgagcggcacaaacagcggagcaagcaagaag cgatttgaagtaaagaagtggaatgctgtggcgctgtgggcctgggacattgtggtggat aactgtgctatctgtcgaaaccacatcatggatctctgtatagagtgccaggccaaccaa gcttctgcaacttctgaggagtgcactgtagcctggggtgtctgcaatcatgccttccat ttccactgtatttctcgctggctgaaaacgagacaggtgtgtcctctggacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system