Seriola dumerili (greater amberjack): 111232130 Help Entry 111232130         CDS       T05606                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu03030   DNA replication sdu03410   Base excision repair sdu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sdu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     111232130 (pole4)    03410 Base excision repair     111232130 (pole4)    03420 Nucleotide excision repair     111232130 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sdu03032]     111232130 (pole4)    03400 DNA repair and recombination proteins [BR:sdu03400]     111232130 (pole4) Enzymes [BR:sdu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      111232130 (pole4) DNA replication proteins [BR:sdu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     111232130 (pole4) DNA repair and recombination proteins [BR:sdu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       111232130 (pole4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  111232130 NCBI-ProteinID:  XP_022615217 UniProt:  A0A3B4U7C1 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MAATVVTPVTPTELDPDRCGSEEESRGAEAEEESSQQQTGPAAAVSHSRLSKLPLARIKA LMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAIDE FAFLEGTLD NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggctgcaacagtggtaacgcctgtcacccccacggagctcgaccctgaccgctgtggg agcgaggaagagagccgcggggccgaggcggaggaggagagcagccagcagcagacaggc cccgctgccgccgtgagccacagccgactgtccaaactcccgctggcccgcatcaaggcg ctcatgaagaccgacccagacgtgtcccttgccagccaggagtctgtattcatcatcgct aaagccacggagttgtttgttgagatgattgccaaagatgccctggtgtacgcccagcaa gggaagaggaaaaccttgcaaagaaaagacttggacaacgcaatagaggccatagatgaa tttgcatttcttgaaggcactctagattaa

DBGET integrated database retrieval system