Seriola dumerili (greater amberjack): 111239004 Help Entry 111239004         CDS       T05606                                  Symbol bcl2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04115   p53 signaling pathway sdu04140   Autophagy - animal sdu04141   Protein processing in endoplasmic reticulum sdu04210   Apoptosis sdu04217   Necroptosis sdu04261   Adrenergic signaling in cardiomyocytes sdu04340   Hedgehog signaling pathway sdu04510   Focal adhesion sdu04621   NOD-like receptor signaling pathway sdu05132   Salmonella infection sdu05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:sdu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111239004 (bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     111239004 (bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111239004 (bcl2)   09143 Cell growth and death    04210 Apoptosis     111239004 (bcl2)    04217 Necroptosis     111239004 (bcl2)    04115 p53 signaling pathway     111239004 (bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111239004 (bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     111239004 (bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     111239004 (bcl2)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     111239004 (bcl2)   09171 Infectious disease: bacterial    05132 Salmonella infection     111239004 (bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sdu01009]     111239004 (bcl2) Protein phosphatases and associated proteins [BR:sdu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      111239004 (bcl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bcl-2_3 BH4 DUF2200 DUF6414 Motif Other DBs NCBI-GeneID:  111239004 NCBI-ProteinID:  XP_022624482 LinkDB All DBs Position Unknown AA seq 228 aa AA seqDB search MASEYNRNIVEKYICHKLSKQGYVWGFDDVRDEDAANNGSIVAPPPTLVRRCREANTGPD NDSSPNLCRRLSQSDPHAEIHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEV IDELFRDGVNWGRIIAFFEFGGTVCVECAAKEEMTSQVDNIVEWMTEYLNGPLNSWIKDN GGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atggcgagcgagtataatcgcaatattgtggaaaagtatatctgccataaactctccaaa caaggatacgtgtggggatttgatgatgtccgagatgaagatgctgctaataatggctca atagttgcccctccaccgactttggtccgccggtgccgtgaagccaacaccgggcctgac aacgacagctcacctaacctctgcagacggctctctcagtccgacccgcacgccgagatc cacagagtcctgcgcgaggctggagacgaacttgagagattataccagccggacttcacg gagatgtcgcggcagctctatctcacctccaccacggcgcagagaagattcgccgaggtg atagacgaactgttccgggacggggtgaattggggccggattatcgctttcttcgagttc gggggcacggtgtgcgttgagtgcgcggccaaggaggagatgacatcgcaggtggacaac atcgtggagtggatgacggagtatttaaatggacctcttaacagctggataaaggataac gggggatgggatgcctttgtggagctgtatgacagacagagggagtccgtcttcagttgc tcctggccctccatcaagacagtcttcggcctggctgcactcggggcagcgagcctcacc atcggagcataccttacacagaagtga

DBGET integrated database retrieval system