Solanum dulcamara (climbing nightshade): 129871323 Help Entry 129871323         CDS       T09577                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sdul  Solanum dulcamara (climbing nightshade) Pathway sdul03420   Nucleotide excision repair sdul04120   Ubiquitin mediated proteolysis sdul04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sdul00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129871323    04120 Ubiquitin mediated proteolysis     129871323   09124 Replication and repair    03420 Nucleotide excision repair     129871323  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sdul04121]     129871323    03400 DNA repair and recombination proteins [BR:sdul03400]     129871323 Enzymes [BR:sdul01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      129871323 Ubiquitin system [BR:sdul04121]  Ubiquitin ligases (E3)   UBL E3 ligases    129871323   Multi subunit type E3    SCF complex     Ring finger protein      129871323    Cul2 complex      129871323    Cul3 complex      129871323    Cul4 complex      129871323    Cul7 complex      129871323    Cul8 complex      129871323    Cul9 complex      129871323 DNA repair and recombination proteins [BR:sdul03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       129871323     TCR (transcription coupled repair) factors      Cul4-CSA complex       129871323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  129871323 NCBI-ProteinID:  XP_055802197 LinkDB All DBs Position 10:complement(1169463..1172981) Genome browser AA seq 116 aa AA seqDB search MASPDNDVLMVPAGEGTTGVGTSNKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaccggataatgacgtgctgatggttcccgccggcgagggtactaccggagtt ggaacgtctaataaaaagccaaagcgatttgagatcaaaaagtggaacgctgtttctctc tgggcttgggatattgtggtagataactgtgcaatctgtaggaatcacattatggatctg tgtatcgagtgtcaagctaatcaggctagcgcaacaagtgaggaatgcacagttgcttgg ggggtttgcaaccatgcattccacttccattgcattagtaggtggctcaagactcgtcaa gtgtgtccacttgataacagcgagtgggagtttcagaagtacggtcactag

DBGET integrated database retrieval system