KEGG   Saccharopolyspora erythraea: SACE_0726
Entry
SACE_0726         CDS       T00492                                 

Symbol
eryCIII
Name
(GenBank) glycosyl transferase, NDP-D-desosamine : 3-L-mycarosyl erythronolide B
  KO
K14368  3-alpha-mycarosylerythronolide B desosaminyl transferase [EC:2.4.1.278]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00522  Biosynthesis of 12-, 14- and 16-membered macrolides
sen01052  Type I polyketide structures
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
Module
sen_M00774  Erythromycin biosynthesis, propanoyl-CoA + methylmalonyl-CoA => deoxyerythronolide B => erythromycin A/B
Brite
KEGG Orthology (KO) [BR:sen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    SACE_0726 (eryCIII)
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    SACE_0726 (eryCIII)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sen01008]
    SACE_0726 (eryCIII)
Enzymes [BR:sen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.278  3-alpha-mycarosylerythronolide B desosaminyl transferase
     SACE_0726 (eryCIII)
Polyketide biosynthesis proteins [BR:sen01008]
 Polyketide tailoring proteins
  Glycosyltransferase
   SACE_0726 (eryCIII)
SSDB
Motif
Pfam: DUF1205 UDPGT Glyco_tran_28_C
Other DBs
NCBI-ProteinID: CAM00067
Kitasato: SACE_0726
Cambridge: SACE_0726
UniProt: A4F7P3
Structure
LinkDB
Position
821335..822600
AA seq 421 aa
MRVVFSSMASKSHLFGLVPLAWAFRAAGHEVRVVASPALTEDITAAGLTAVPVGTDVDLV
DFMTHAGHDIIDYVRSLDFSERDPATLTWEHLLGMQTVLTPTFYALMSPDTLIEGMVSFC
RKWRPDLVIWEPLTFAAPIAAAVTGTPHARLLWGPDITTRARQNFLGLLPDQPEEHREDP
LAEWLTWTLEKYGGPAFDEEVVVGQWTIDPAPAAIRLDTGLKTVGMRYVDYNGPSVVPEW
LHDEPERRRVCLTLGISSRENSIGQVSIEELLGAVGDVDAEIIATFDAQQLEGVANIPDN
VRTVGFVPMHALLPTCAATVHHGGPGSWHTAAIHGVPQVILPDGWDTGVRAQRTQEFGAG
IALPVPELTPDQLRESVKRVLDDPAHRAGAARMRDDMLAEPSPAEVVGICEELAAGRREP
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcgcgtcgtcttctcctccatggccagcaagagccacctcttcggcctcgtccccctc
gcatgggcgttccgcgcggcggggcacgaggtccgcgtggtcgcgtccccggcgctcacc
gaggacatcaccgcggccgggctgaccgccgtcccggtcggcaccgacgtcgacctcgtg
gacttcatgacccacgcgggccacgacatcatcgactacgtccggagcctggacttcagc
gagcgggaccccgccaccttgacctgggagcacctgctgggcatgcagaccgtgctcacc
ccgaccttctacgccctgatgagcccggacacgctcatcgaaggcatggtctcgttctgc
cggaagtggcggcccgacctggtcatctgggagccgctcaccttcgccgcgcccatcgcg
gcggcggtgaccggaacgccgcacgcgcggctgctgtggggacccgacatcaccacccgg
gcgcggcagaacttcctcggcctgctgcccgaccagccggaggagcaccgggaggacccg
ctcgccgagtggctcacctggacgctggagaagtacggcggcccggccttcgacgaggag
gtggtcgtcgggcagtggacgatcgaccccgccccggccgcgatcaggctcgacaccggc
ctgaagaccgtcgggatgcgctacgtcgactacaacgggccgtccgtggtgccggaatgg
ctgcacgacgagcccgagcgccgccgcgtgtgcctcacgctcgggatctccagccgcgag
aacagcatcgggcaggtctccatcgaggagctgctgggtgccgtcggcgacgtcgacgcc
gagatcatcgcgaccttcgacgcgcagcagctagaaggcgtcgcgaacatcccggacaac
gtccgcacggtcggcttcgtcccgatgcacgcgctgctgccgacctgcgcggcgacggtg
caccacggcggacccgggagctggcacaccgcggcgatccacggcgtgccgcaggtgatc
ctgcccgacggctgggacaccggcgtgcgcgcgcagcgcacgcaggaattcggggcgggg
atcgcgctgcccgtgcccgagctgacccccgaccagctccgggagtcggtgaagcgggtc
ctcgacgacccggcccaccgcgccggcgcggcgcggatgcgcgacgacatgctcgcggag
ccgtcaccggccgaggtcgtcggcatctgcgaggaactggccgcaggaaggagagaacca
cgatga

DBGET integrated database retrieval system