Serratia sp. FS14: L085_19180 Help Entry L085_19180        CDS       T03313                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism serf  Serratia sp. FS14 Pathway serf01100   Metabolic pathways serf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:serf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L085_19180 (acpP)    00074 Mycolic acid biosynthesis     L085_19180 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L085_19180 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AIA49241 LinkDB All DBs Position complement(4171761..4171997) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgagcaactgggtgttaaacag gaagaagttttgaacaacgcttctttcgttgaagatctgggcgctgattctcttgacacc gttgagctggtaatggcactggaagaagaattcgacaccgagattccagacgaagaagct gagaagatcactactgttcaggcagctattgatttcatcaacgctagccagcagtaa

DBGET integrated database retrieval system