KEGG   Serratia sp. FS14: L085_23050
Entry
L085_23050        CDS       T03313                                 
Name
(GenBank) aminotransferase
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
serf  Serratia sp. FS14
Pathway
serf00333  Prodigiosin biosynthesis
serf01100  Metabolic pathways
serf01110  Biosynthesis of secondary metabolites
Module
serf_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    L085_23050
Enzymes [BR:serf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     L085_23050
SSDB
Motif
Pfam: Aminotran_3 DUF5587
Other DBs
NCBI-ProteinID: AIA50007
UniProt: A0A0J9X1Q5
Structure
LinkDB
Position
5000239..5002800
AA seq 853 aa
MKFGFIAHPTSLGLKRYVKMLDLLQRNSTEQHSGYTRELWERQNLVPFMNFARITSATGA
TCEGVIKYMPLVADEMLADARGIAARVVQGIEELAGDGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYKALMQIQSWLEIRPEEEPVAIVGYPGSICLALSRLLLAHGFS
LHLLHRAGNHDRSELLSHLPEEYHSRVTLTSDPEDLYPRCKLFAAATSAGGVIDPARLQP
GSIFIDVALPRDIASETRPARDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALENRRENFSLGRYLAPEKVLEIGEIAERHGFFAYPLASYGERIDRQSVTNLKRYYH
HDIYAGESADAALPASRLAFIDAVIAQTPAREDTLDRYHQYINPMMVDFLKLQRCDNVFR
SAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPNFIQYISIPEQTA
KLAEVLCRLAPGNMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSI
TGRDKHRRYFTPLLDAMVEVPFGDLAALREALNREDVGALMIEPIQGEGGVHIPPAGYLQ
AVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCR
ADLWQKAYGTADRFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSE
IAARYPFVSEVRGRGLMLGIQFDQAFTGAVNASAREFATRLPGDWHTTWKFLPDPVQAHL
RAAMDRMEQALGEMFCMKFVTKLCQDHKILTFITANSSTVIRIQPPLIISKAEIDRFVGA
FATVCEELSTFLD
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaaattcggattcatcgctcatcccacctcgctggggttgaaacgttacgtcaaaatg
ctcgatctgctgcaacgcaactcgaccgagcagcacagcggctatacgcgtgaactgtgg
gaacgacaaaacctggttccctttatgaacttcgccaggatcacctcggcgaccggcgcc
acttgcgaaggggtgatcaaatacatgccgctggtggcggatgaaatgctggccgacgca
cgcggtatcgccgccagggtggtccaaggcatcgaagagctggccggcgatggcgccgaa
ctggtcggtctcggcggttttacctctatcgttgggcgacgcggcgaagccactgcggaa
aagtcgccggtgccggtcacctccggcaactcgctgaccacctacgccggctacaaggcc
ttgatgcagatccagtcctggctggaaatccgcccggaggaggaacccgtcgccatcgtc
ggctatccgggatcgatctgcctggcgctaagccgtctgctgctggcgcacggtttctct
ctccatttgctgcaccgcgccggcaaccacgatcgcagcgaactgctcagccatttgccc
gaggagtatcactcgcgcgtcaccctgaccagcgatcccgaagatctctacccgcgctgc
aaactgtttgccgccgcgacctccgccggcggcgtgatcgaccccgccagactgcaaccc
ggctcgatcttcatcgacgtggcgctgccgcgcgatatcgcttcggaaacgcgcccggcg
cgggatgacattctgatcatcgacggcggctgcgtcaccgccaccgatgcggtcaagttg
ggtggagaatcgctcaacgtcaccatcaagcaacaattgaacggctgcatggcggaaacc
attgtgctggcgctggaaaaccggcgggaaaacttttcgctgggccgctatctggcgccg
gaaaaagtgctggagatcggtgaaatcgccgagcgccacgggttcttcgcctatccgctg
gcctcgtacggcgagcgcatcgatcggcagagcgtgaccaatctcaagcgctactaccac
catgacatctatgccggggaatcggctgatgcggcgttgcccgcatcgcgcctggcgttt
atcgacgcggtcatcgcccaaacgccggccagggaagacaccctcgaccgctatcatcaa
tacatcaaccccatgatggtggacttcctcaagttgcagcgctgcgacaacgttttccgc
agcgccgccggcacccagttgtatgacgatgcgggcgaggctttcctggacatggtggcg
ggctacgggtgcctaaacctgggccacaacccgcagccagtggtcaacgcgctgaaaaac
tacctcgacgctcaaggccccaacttcattcaatacatttccattcccgaacagaccgcc
aagctggccgaagtgctctgtcgtctggcgccgggcaacatgggccgggtgttcttcagc
aactccggcaccgaagccgtcgaggccgcgatgaagatcgccaaggcctcgacgggcaag
ccgggcatcgcctatctgcgcaacagttaccacggtaaaacgctgggcgcgttgtccatc
accggacgagacaaacaccgccgctatttcacaccgctgctggacgcgatggtggaagtg
ccgttcggcgatctcgccgcgctgcgggaagcgctgaaccgtgaagacgtcggcgcgctg
atgatcgaaccgatccagggcgaaggcggcgtgcatatcccgcccgccggttacctgcag
gcggtgcagcagctctgccgcgagaccggcgtgctgctgatggtggacgaagtgcaaacc
gggcttgggcgcaccggcaaacttttcgcctgcgaatgggacggtatcgaaccggacgtg
ctgatgctgtcgaaatccctgtccggcggcctgatccccatcggcgccacgctgtgccga
gccgatctttggcaaaaagcctatggcacggcggatcgcttcctggtgcacagctccacc
tacggcggcggcaacctcgcctcggtcgtcgccctcagcgcgctgcgcgagatcctggcg
caggatttggtcggccatgccgaacggatgggcgcctactttaagcaggcactgagcgag
atcgccgcccgctatccgttcgtcagcgaggtgcgcggccgcggcctgatgctggggatc
cagttcgaccaggcgttcaccggcgcggtcaacgcctccgcccgcgaattcgccacccgg
ctgccgggcgattggcacaccacctggaaattcttgcccgatccggtgcaagcccatctg
cgggcggcgatggatcgcatggaacaggcgctcggcgaaatgttctgcatgaaattcgtc
accaagctgtgccaggaccacaagatcctgaccttcattaccgccaacagctcgacggtg
atccgtattcaacccccgctcatcatcagcaaagccgagatcgaccgtttcgtcggcgcc
tttgccacggtgtgcgaggaactctccacctttttagactag

DBGET integrated database retrieval system