Serratia sp. NGAS9: GUC32_03250 Help Entry GUC32_03250       CDS       T10949                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism sern  Serratia sp. NGAS9 Pathway sern00670   One carbon pool by folate sern00790   Folate biosynthesis sern01100   Metabolic pathways sern01240   Biosynthesis of cofactors sern04981   Folate transport and metabolism Module sern_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sern00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GUC32_03250 (folA)    00670 One carbon pool by folate     GUC32_03250 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     GUC32_03250 (folA) Enzymes [BR:sern01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      GUC32_03250 (folA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QHI76643 LinkDB All DBs Position 698518..699000 Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRHN IVLSSRPGNAAGVTWVTSLDEALAAAGEVEEVMVIGGGRIYTQLLPRADRLYLTHIDAEV GGDTHFPDYEPDEWETTFSEFHDADELNSHSYCFEILQRR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgatcgctgccttggcggcggatcgcgttattggcatggaaaacgcc atgccgtggcacctgccggcggacctggcgtggtttaaacgcaacacgttgaataagccg gttattatgggccgcaagaccttcgagtccatcggccgcccgctgccgggccgccacaat atcgttttgagcagccgcccaggtaatgccgccggggtgacctgggtgacctcgctggat gaggcgctggccgccgcgggtgaggtggaagaagtgatggtgatcggcggtgggcgcatc tatacccagctgctgccgcgcgccgatcgcctgtacctgacgcacatcgacgccgaagtc ggcggtgatactcacttcccggattacgagccggacgagtgggaaaccacgttcagcgaa ttccacgacgccgacgagctgaattcgcacagctactgcttcgaaatcctgcagcgccgc tga

DBGET integrated database retrieval system