KEGG   Salmonella enterica subsp. arizonae: SARI_03504
Entry
SARI_03504        CDS       T00627                                 
Name
(GenBank) hypothetical protein
  KO
K23654  T3SS secreted effector NleE
Organism
ses  Salmonella enterica subsp. arizonae
SSDB
Motif
Pfam: NleE DUF3958
Other DBs
NCBI-ProteinID: ABX23329
LinkDB
Position
3435964..3436653
AA seq 229 aa
MELQMKIPSINNQNISFPDRINAIDIIMKTYPDVTPYFFMEKPNIYDQKYISGITREQSV
FKVNGYINKKAELTHYMQRMYSDSHINFKTISRDEANTSEGSWLTVITGKRPMGQFSVDS
LYSPVLHSLLELPNIGCKIFPKEDNSFLYIIVVYRKDCAQGEQYADRFIELYNKKRELMC
DMSNESNELKTIKSELVVAREMGTILSYLPEEIDNYISKMNLLFLKKTN
NT seq 690 nt   +upstreamnt  +downstreamnt
atggaattgcaaatgaaaatacccagcattaacaatcaaaacatttcgtttccggatcgg
attaatgcgatagatataataatgaaaacttatcctgatgtaactccttattttttcatg
gaaaaaccaaatatttatgatcagaaatacatttcaggtataaccagagaacagtctgta
tttaaagttaatggatacattaataaaaaagcagaactcactcattatatgcaacgtatg
tattcagactctcacattaattttaaaaccatctccagggatgaagccaacacctctgaa
ggaagttggttaactgttattacagggaaacgtccaatgggacagttttcagtagatagt
ctttattcaccggtgttgcattcattgcttgaactaccaaatattggatgtaaaattttc
cccaaagaggacaatagttttttatatataatagtagtatacagaaaagattgtgcgcag
ggtgaacaatatgcagaccgatttattgaattatacaataaaaaaagagaattaatgtgt
gatatgagtaatgagtctaatgaattgaaaacaataaaatcagagcttgttgtcgcaagg
gagatgggaacaattttaagttacttaccagaggaaatagataattatatctctaaaatg
aatttattatttttaaaaaaaactaattaa

DBGET integrated database retrieval system