KEGG   Shewanella eurypsychrophilus: FM038_016050
Entry
FM038_016050      CDS       T07746                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
seur  Shewanella eurypsychrophilus
Pathway
seur00541  O-Antigen nucleotide sugar biosynthesis
seur01100  Metabolic pathways
seur01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:seur00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    FM038_016050
SSDB
Motif
Pfam: CTP_transf_3 IspD NTP_transf_3
Other DBs
NCBI-ProteinID: QPG58761
UniProt: A0A7S9J023
LinkDB
Position
complement(3810908..3811642)
AA seq 244 aa
MNRKVLALIPARAGSQRLVGKNIKPLHGKPLIAWSITVALSTPGITDVVVTTDCDDIAAI
SKVFGAEVPFLRPAHLATPHASSIDVVIHGIESMSKLGKNYDYVLLLQPTSPLREARDIE
AALSLIENGRVNGVVSVCECEHSPLWSNVLPDSNSLEDFIPEELNDVRSQDLPRYYRFNG
AIYLYKIESLMKSRSLFLAPEVVALPMVQENSIDIDNELDFKLAQLILEQRIKQTDKSNE
GVSC
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaatagaaaagtgttagccttgataccagctagagctggaagccaaaggctcgtaggt
aaaaatattaaaccgctacatggcaaaccattaattgcttggagtataactgttgccttg
tctacaccaggtattacagatgtggttgtaactactgattgcgatgatattgctgctatc
tcgaaagtattcggagctgaggttccttttctgcgaccagctcaccttgcaacacctcat
gcatcttcgatcgatgttgttatacatggcatagaaagcatgtccaaactaggtaaaaac
tatgactatgtccttctacttcaacctacatctccgttgagagaggcccgagatattgaa
gctgcactttctctgatagagaatggcagggttaacggggttgtatcagtttgtgagtgt
gaacatagtcctttatggtccaatgttctaccggactcaaattcccttgaggattttatt
cccgaagaactcaacgatgttagaagccaagatttaccaaggtattatcgctttaatggg
gctatttacttgtataaaatcgaatctttgatgaaaagtcgcagcctgtttcttgctcct
gaagtcgtcgcgcttcctatggttcaggagaattcaatcgatattgacaacgaactcgac
tttaaacttgcccagcttattctagagcagcgtattaaacaaactgataaatcaaatgag
ggagtatcatgttag

DBGET integrated database retrieval system