Serratia fonticola GS2: AV650_07415 Help Entry AV650_07415       CDS       T04716                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism sfg  Serratia fonticola GS2 Pathway sfg00670   One carbon pool by folate sfg00790   Folate biosynthesis sfg01100   Metabolic pathways sfg01240   Biosynthesis of cofactors sfg04981   Folate transport and metabolism Module sfg_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sfg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AV650_07415 (folA)    00670 One carbon pool by folate     AV650_07415 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     AV650_07415 (folA) Enzymes [BR:sfg01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      AV650_07415 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ALX93398 UniProt:  A0A0F7HBH3 LinkDB All DBs Position 1609769..1610251 Genome browser AA seq 160 aa AA seqDB search MIISLIAALAADRVIGMENAMPWHLPEDLAWFKRNTLNKPVIMGRKTFESIGRPLPGRHN IVLSSQPGKEPGVTWVTSLEEALAAAGEVEEVMVMGGGSIYSQFLPRASRMYLTHIDAEV GGDTYFPDYEPDEWETSFSAFHDADALNSHGYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatcagcctgattgctgctttggcggcggatcgcgttattggtatggaaaatgcc atgccgtggcacctgccggaggatttggcgtggtttaaacgtaatacgttaaacaaaccg gtgattatgggccgtaagacctttgagtcgattggccgtcccttgccgggccgtcataat atcgtattaagcagccagccgggtaaagaacctggcgtgacctgggtaacgtcgctggag gaggctttggctgcggctggcgaggtggaggaagtgatggtgatgggcggtggcagcatt tatagccagttcctgccacgggcttcccgaatgtatctgacgcatatcgatgccgaagta ggcggagatacctacttcccggattacgagccagatgaatgggaaacctcattcagcgcc ttccacgatgcggacgcactgaactcgcacggctactgttttgagattctggaacgccgc taa

DBGET integrated database retrieval system