Scleropages formosus (Asian bonytongue): 108921800 Help Entry 108921800         CDS       T04919                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm03008   Ribosome biogenesis in eukaryotes sfm03013   Nucleocytoplasmic transport sfm03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:sfm00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     108921800 (ran)    03008 Ribosome biogenesis in eukaryotes     108921800 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     108921800 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sfm03019]     108921800 (ran)    03009 Ribosome biogenesis [BR:sfm03009]     108921800 (ran)    03016 Transfer RNA biogenesis [BR:sfm03016]     108921800 (ran)    03036 Chromosome and associated proteins [BR:sfm03036]     108921800 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfm04147]     108921800 (ran)    04031 GTP-binding proteins [BR:sfm04031]     108921800 (ran) Messenger RNA biogenesis [BR:sfm03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      108921800 (ran) Ribosome biogenesis [BR:sfm03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     108921800 (ran)   Pre-60S particles     108921800 (ran) Transfer RNA biogenesis [BR:sfm03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     108921800 (ran) Chromosome and associated proteins [BR:sfm03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      108921800 (ran)    Spindle formation proteins     108921800 (ran) Exosome [BR:sfm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108921800 (ran) GTP-binding proteins [BR:sfm04031]  Small (monomeric) G-proteins   Ran Family    Ran     108921800 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RNA_helicase G-alpha AAA_24 Pox_A32 ArgoMid Septin AAA_7 SRPRB TsaE AAA_16 AAA_22 DUF5906 AAA_33 Motif Other DBs NCBI-GeneID:  108921800 NCBI-ProteinID:  XP_018587028 UniProt:  A0A0P7Y045 LinkDB All DBs Position 17:complement(25763162..25768070) Genome browser AA seq 216 aa AA seqDB search MAMQAEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLMFHTNRGAIK FNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC GNKVDIKDRKVKAKAIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMP ALAPPEVVMDPQLAKQYEEDLQVAQSTALPDDEDDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcaatgcaggcagaaccccaggttcagttcaaactggttttggtgggagatggtggt acgggtaaaaccacctttgtgaagcgccatttgactggagaatttgagaagaagtatgta gctaccctgggtgtcgaagtccaccctcttatgtttcacaccaacagaggagcgatcaaa ttcaacgtgtgggatacagctggacaggagaaatttggtggtctccgagatgggtattac atacaagcccagtgtgccataattatgtttgacgtgacatccagggtaacatacaaaaat gttcccaactggcacagagacttggttcgagtgtgtgagaacatccccatagtcctgtgt ggtaacaaggtagacatcaaagataggaaagtcaaagcaaaagccatcgttttccacaga aagaagaatcttcagtactatgacatctctgccaagagcaactacaactttgagaagccc ttcctgtggttggcaaggaagctgattggtgacccaaacctcgagtttgtagccatgcct gccctggctcccccagaggtagtgatggatccccagctggccaagcagtatgaggaggac ctgcaggtggcccagtccacggccctgccagacgacgaggatgacctgtga

DBGET integrated database retrieval system