Scleropages formosus (Asian bonytongue): 108926071 Help Entry 108926071         CDS       T04919                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm03420   Nucleotide excision repair sfm04110   Cell cycle sfm04114   Oocyte meiosis sfm04120   Ubiquitin mediated proteolysis sfm04141   Protein processing in endoplasmic reticulum sfm04310   Wnt signaling pathway sfm04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sfm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108926071 (rbx1)    04120 Ubiquitin mediated proteolysis     108926071 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     108926071 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108926071 (rbx1)    04350 TGF-beta signaling pathway     108926071 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     108926071 (rbx1)    04114 Oocyte meiosis     108926071 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sfm04121]     108926071 (rbx1)    03400 DNA repair and recombination proteins [BR:sfm03400]     108926071 (rbx1) Enzymes [BR:sfm01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108926071 (rbx1) Ubiquitin system [BR:sfm04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108926071 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      108926071 (rbx1)    Cul2 complex      108926071 (rbx1)    Cul3 complex      108926071 (rbx1)    Cul4 complex      108926071 (rbx1)    Cul7 complex      108926071 (rbx1)    Cul8 complex      108926071 (rbx1)    Cul9 complex      108926071 (rbx1) DNA repair and recombination proteins [BR:sfm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108926071 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       108926071 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  108926071 NCBI-ProteinID:  XP_018594050 UniProt:  A0A8C9RJ32 LinkDB All DBs Position 3:29871860..29873580 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgctatggatgtggatactccaagtggcgctaatagcggagctagcaagaaa cgttttgaagtgaagaagtggaatgctgtggcgctctgggcttgggacattgtggttgac aactgtgcaatttgtcggaatcatattatggatctctgtatagagtgccaggccaaccaa gcatctgctacatctgaggagtgcacagttgcctggggtgtctgcaatcatgctttccat ttccactgcatctctcgttggctgaagacgcgtcaggtgtgtcctctggataacagggag tgggaatttcaaaagtatggacactaa

DBGET integrated database retrieval system