Scleropages formosus (Asian bonytongue): 108933304 Help Entry 108933304         CDS       T04919                                  Symbol il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism sfm  Scleropages formosus (Asian bonytongue) Pathway sfm04060   Cytokine-cytokine receptor interaction sfm04068   FoxO signaling pathway sfm04218   Cellular senescence sfm04620   Toll-like receptor signaling pathway sfm04621   NOD-like receptor signaling pathway sfm04623   Cytosolic DNA-sensing pathway sfm04625   C-type lectin receptor signaling pathway sfm04672   Intestinal immune network for IgA production sfm05132   Salmonella infection sfm05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:sfm00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     108933304 (il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108933304 (il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     108933304 (il6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108933304 (il6)    04621 NOD-like receptor signaling pathway     108933304 (il6)    04623 Cytosolic DNA-sensing pathway     108933304 (il6)    04625 C-type lectin receptor signaling pathway     108933304 (il6)    04672 Intestinal immune network for IgA production     108933304 (il6)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     108933304 (il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     108933304 (il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfm04052]     108933304 (il6) Cytokines and neuropeptides [BR:sfm04052]  Cytokines   Interleukins    108933304 (il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 FAD_SOX Motif Other DBs NCBI-GeneID:  108933304 NCBI-ProteinID:  XP_029103866 LinkDB All DBs Position 23:9110834..9112403 Genome browser AA seq 149 aa AA seqDB search MQFAEKFPKENMESFKDHKVPVPHLVVEDGCFSLNFSKKRCLQRVADGLQRYQVYLEFVE KEFPQQSRVRDIMNKASSLVHIIREKEKTVQLEVLEPAVKKQLLGELPSSSRWSRSISVH GVLSRMSAFAADAFRAIRYINQRLRRGRP NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgcagtttgctgagaagttcccgaaagaaaacatggagtccttcaaagaccacaaggtg ccagtgcctcacctggtcgtggaggacggctgtttctccctcaacttcagcaaaaagagg tgcctccagcgcgtggcggacgggctccagcgctaccaggtgtacctggagttcgtggag aaggagttcccgcagcagagccgtgtgcgggacatcatgaacaaggcgagcagcctcgtc cacatcatccgagagaaagagaagacggtgcagctggaggtgctggagcccgctgtgaag aagcagctgctcggcgaactgcccagcagctccaggtggagccgcagcatcagcgtccac ggcgtcctgagccgcatgagcgccttcgccgcggacgcgttccgggccatccgctatatc aaccagcggctgcggagagggcggccctga

DBGET integrated database retrieval system