Salvelinus fontinalis (brook trout): 129861871 Help Entry 129861871         CDS       T11136                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism sfon  Salvelinus fontinalis (brook trout) Pathway sfon00510   N-Glycan biosynthesis sfon00513   Various types of N-glycan biosynthesis sfon04141   Protein processing in endoplasmic reticulum Module sfon_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:sfon00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     129861871 (tmem258)    00513 Various types of N-glycan biosynthesis     129861871 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129861871 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  129861871 NCBI-ProteinID:  XP_055789006 LinkDB All DBs Position 9:1417409..1420275 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggctatgactcgatacaccagtccggtgaacccggcagtcttcccacac ctcactgtggtcctactggctatcggcatgttcttcaccgcgtggttctttgtctacgag gtaacgtccactaaatacaccagagacgtgtacaaagagctgctcatctccctggtggcg tctctcttcatgggcttcggagtgctgtttctgttactgtgggtcggcatctatgtctga

DBGET integrated database retrieval system