Sorex fumeus (smoky shrew): 130024947 Help Entry 130024947         CDS       T10594                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum03082   ATP-dependent chromatin remodeling sfum04015   Rap1 signaling pathway sfum04145   Phagosome sfum04210   Apoptosis sfum04390   Hippo signaling pathway sfum04510   Focal adhesion sfum04520   Adherens junction sfum04530   Tight junction sfum04611   Platelet activation sfum04613   Neutrophil extracellular trap formation sfum04670   Leukocyte transendothelial migration sfum04714   Thermogenesis sfum04810   Regulation of actin cytoskeleton sfum04814   Motor proteins sfum04820   Cytoskeleton in muscle cells sfum04919   Thyroid hormone signaling pathway sfum04921   Oxytocin signaling pathway sfum04971   Gastric acid secretion sfum05014   Amyotrophic lateral sclerosis sfum05100   Bacterial invasion of epithelial cells sfum05132   Salmonella infection sfum05135   Yersinia infection sfum05164   Influenza A sfum05205   Proteoglycans in cancer sfum05225   Hepatocellular carcinoma sfum05410   Hypertrophic cardiomyopathy sfum05412   Arrhythmogenic right ventricular cardiomyopathy sfum05414   Dilated cardiomyopathy sfum05416   Viral myocarditis sfum05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:sfum00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     130024947 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     130024947 (ACTG1)    04390 Hippo signaling pathway     130024947 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130024947 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     130024947 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130024947 (ACTG1)    04520 Adherens junction     130024947 (ACTG1)    04530 Tight junction     130024947 (ACTG1)   09142 Cell motility    04814 Motor proteins     130024947 (ACTG1)    04820 Cytoskeleton in muscle cells     130024947 (ACTG1)    04810 Regulation of actin cytoskeleton     130024947 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     130024947 (ACTG1)    04613 Neutrophil extracellular trap formation     130024947 (ACTG1)    04670 Leukocyte transendothelial migration     130024947 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     130024947 (ACTG1)    04919 Thyroid hormone signaling pathway     130024947 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     130024947 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     130024947 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     130024947 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     130024947 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     130024947 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     130024947 (ACTG1)    05135 Yersinia infection     130024947 (ACTG1)    05100 Bacterial invasion of epithelial cells     130024947 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     130024947 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     130024947 (ACTG1)    05410 Hypertrophic cardiomyopathy     130024947 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     130024947 (ACTG1)    05414 Dilated cardiomyopathy     130024947 (ACTG1)    05416 Viral myocarditis     130024947 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:sfum03021]     130024947 (ACTG1)    03019 Messenger RNA biogenesis [BR:sfum03019]     130024947 (ACTG1)    03036 Chromosome and associated proteins [BR:sfum03036]     130024947 (ACTG1)    03029 Mitochondrial biogenesis [BR:sfum03029]     130024947 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sfum04812]     130024947 (ACTG1)    04147 Exosome [BR:sfum04147]     130024947 (ACTG1) Transcription machinery [BR:sfum03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      130024947 (ACTG1) Messenger RNA biogenesis [BR:sfum03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      130024947 (ACTG1) Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      130024947 (ACTG1)     NuA4 complex      130024947 (ACTG1)   Chromatin remodeling factors    BAF complex     130024947 (ACTG1)    PBAF complex     130024947 (ACTG1)    GBAF(ncBAF) complex     130024947 (ACTG1)    SWR1 complex     130024947 (ACTG1) Mitochondrial biogenesis [BR:sfum03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     130024947 (ACTG1) Cytoskeleton proteins [BR:sfum04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      130024947 (ACTG1) Exosome [BR:sfum04147]  Exosomal proteins   Proteins found in most exosomes    130024947 (ACTG1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  130024947 NCBI-ProteinID:  XP_055971766 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaggaggaaatcgccgcgctcgtcatcgacaacggctcgggcatgtgcaaggcgggc ttcgcgggcgacgacgcgccccgcgccgtgttcccgtccatcgtgggccgcccgcgccac cagggcgtgatggtgggcatgggccagaaggactcgtacgtgggcgacgaggcgcagagc aagcgcggcatcctgacgctcaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcgcccgaggag cacccggtgctgctgacggaggcgccgctgaaccccaaggccaaccgcgagaagatgacc cagatcatgttcgagaccttcaacacgcccgccatgtacgtggccatccaggctgtgctg tccctgtacgcctcgggccgcaccacgggcatcgtgatggactccggcgacggggtcacc cacacggtgcccatctatgagggctacgcgctgccccacgccatcctgcgtctggacctg gccggccgggacctgaccgactacctcatgaagatcctcacggagcgcggctacagcttc accaccaccgccgagcgggagatcgtgcgcgacatcaaggagaagctgtgctacgtggcg ctggacttcgagcaggagatggccacggcggcctcctcatcctctctggagaagagctac gagctgcccgacggccaggtgatcaccattggcaatgagcgtttccgctgcccggaggcg ctcttccagccctccttcctcggcatggagtcttgcggcatccacgagaccaccttcaac tccatcatgaagtgtgacgtggacatccggaaggacctgtacgccaacacggtgctctca gggggcaccaccatgtacccgggcatcgccgaccggatgcagaaggagatcacagccctg gcccccagcaccatgaagatcaagatcatcgcaccccctgagcgcaagtactcggtgtgg atcgggggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system