Sorex fumeus (smoky shrew): 130033065 Help Entry 130033065         CDS       T10594                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04060   Cytokine-cytokine receptor interaction sfum04151   PI3K-Akt signaling pathway sfum04630   JAK-STAT signaling pathway sfum04640   Hematopoietic cell lineage sfum04657   IL-17 signaling pathway sfum04658   Th1 and Th2 cell differentiation sfum04659   Th17 cell differentiation sfum04660   T cell receptor signaling pathway sfum04664   Fc epsilon RI signaling pathway sfum04672   Intestinal immune network for IgA production sfum05140   Leishmaniasis sfum05200   Pathways in cancer sfum05310   Asthma sfum05320   Autoimmune thyroid disease sfum05321   Inflammatory bowel disease sfum05330   Allograft rejection Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     130033065 (IL4)    04151 PI3K-Akt signaling pathway     130033065 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130033065 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     130033065 (IL4)    04660 T cell receptor signaling pathway     130033065 (IL4)    04658 Th1 and Th2 cell differentiation     130033065 (IL4)    04659 Th17 cell differentiation     130033065 (IL4)    04657 IL-17 signaling pathway     130033065 (IL4)    04664 Fc epsilon RI signaling pathway     130033065 (IL4)    04672 Intestinal immune network for IgA production     130033065 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     130033065 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     130033065 (IL4)   09163 Immune disease    05310 Asthma     130033065 (IL4)    05320 Autoimmune thyroid disease     130033065 (IL4)    05321 Inflammatory bowel disease     130033065 (IL4)    05330 Allograft rejection     130033065 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfum04052]     130033065 (IL4)    00536 Glycosaminoglycan binding proteins [BR:sfum00536]     130033065 (IL4) Cytokines and neuropeptides [BR:sfum04052]  Cytokines   Interleukins    130033065 (IL4) Glycosaminoglycan binding proteins [BR:sfum00536]  Heparan sulfate / Heparin   Cytokines    130033065 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  130033065 NCBI-ProteinID:  XP_055980736 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MGLASQLMPTLLCLLACTSNMGAHVHRKTIVLREVIRTLNTLTEKKDACLELTVADVFAA PKNTTRTEIFCRAATTIRQFYKEHKCLHRFPKGLYKNLSNLANMVS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgggtctcgcctcccaactgatgcccactctgctctgcttactagcatgtaccagcaac atgggggcccatgtacacagaaagactattgtcctgcgagaggtcatcagaacgctgaac acacttacagaaaaaaaggatgcctgtctggagctgactgtagcagatgtcttcgctgcc ccaaagaatacaaccaggacagaaatcttctgcagggccgccactacgatccggcagttc tataaggagcacaaatgtttacatcgtttcccgaaagggctctacaagaatcttagcaac ctggccaacatggtgagctga

DBGET integrated database retrieval system