Sorex fumeus (smoky shrew): 130040052 Help Entry 130040052         CDS       T10594                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04010   MAPK signaling pathway sfum04014   Ras signaling pathway sfum04015   Rap1 signaling pathway sfum04024   cAMP signaling pathway sfum04062   Chemokine signaling pathway sfum04510   Focal adhesion sfum04517   IgSF CAM signaling sfum04520   Adherens junction sfum04611   Platelet activation sfum04670   Leukocyte transendothelial migration sfum04720   Long-term potentiation sfum04722   Neurotrophin signaling pathway sfum04934   Cushing syndrome sfum04972   Pancreatic secretion sfum05211   Renal cell carcinoma sfum05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130040052    04014 Ras signaling pathway     130040052    04015 Rap1 signaling pathway     130040052    04024 cAMP signaling pathway     130040052   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     130040052  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     130040052    04520 Adherens junction     130040052  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     130040052    04670 Leukocyte transendothelial migration     130040052    04062 Chemokine signaling pathway     130040052   09154 Digestive system    04972 Pancreatic secretion     130040052   09156 Nervous system    04720 Long-term potentiation     130040052    04722 Neurotrophin signaling pathway     130040052  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     130040052   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     130040052   09167 Endocrine and metabolic disease    04934 Cushing syndrome     130040052  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130040052    04031 GTP-binding proteins [BR:sfum04031]     130040052 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130040052   Exosomal proteins of other body fluids (saliva and urine)    130040052   Exosomal proteins of colorectal cancer cells    130040052 GTP-binding proteins [BR:sfum04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     130040052 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 PucR-like_N Motif Other DBs NCBI-GeneID:  130040052 NCBI-ProteinID:  XP_055988087 LinkDB All DBs Position Unknown AA seq 240 aa AA seqDB search CTLREYKRVVFSSGGVGKSALTVQFVQRIFVEKYDSTIEDSYRKQVEVDVQQCMLEILDT AGAEQFTAMRNLYMKNGQGFVLVYSITAQSTCNDLQDQREQILRVKDTDDVPVILVGNKC DLEDGRIVGKEQGQNRARQWNNCAFLGSSAKSKINVNEIFYDLVWQINRKNPVPGNHLSS LNLHFECLVRPAKSPPDLIHEMHCSSEPGLKNCCPIQQCQQSNFIKPTNILNGLSCGGTL NT seq 723 nt NT seq  +upstreamnt  +downstreamnt tgcaccttgcgtgaatacaagcgtgtggttttcagctcaggaggtgtaggaaaatctgct ctgactgtccagtttgttcaaagaatttttgttgaaaaatacgattctacgatagaagac tcttacagaaagcaagttgaagtagatgtacaacaatgtatgcttgaaatcttggatacc gcaggagcagaacaatttacagcaatgaggaatttgtacatgaaaaatggacaaggcttt gtattagtgtattccatcacagcacagtctacatgtaatgatttacaagatcagagagaa cagattcttcgagttaaagacactgatgacgttccagtgattctggttggtaacaagtgt gacttggaagatggaagaattgtaggaaaggaacaaggtcaaaatcgagcaagacaatgg aacaactgtgcattcttagggtcctctgcaaaatcaaaaataaatgttaatgagatcttt tatgacctcgtgtggcaaattaacagaaaaaatccagtgcctggtaatcacttatcttca cttaatcttcactttgagtgcctggtaaggccggcaaaaagtcctcctgatttaatacac gaaatgcattgtagctctgagccaggtctgaagaattgttgcccaattcaacagtgccag caatccaactttattaaacctaccaacatcttaaatggactttcctgtggtggtactctt taa

DBGET integrated database retrieval system