Sorex fumeus (smoky shrew): 130042343 Help Entry 130042343         CDS       T10594                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum01521   EGFR tyrosine kinase inhibitor resistance sfum04010   MAPK signaling pathway sfum04014   Ras signaling pathway sfum04015   Rap1 signaling pathway sfum04020   Calcium signaling pathway sfum04151   PI3K-Akt signaling pathway sfum04550   Signaling pathways regulating pluripotency of stem cells sfum04810   Regulation of actin cytoskeleton sfum05167   Kaposi sarcoma-associated herpesvirus infection sfum05200   Pathways in cancer sfum05205   Proteoglycans in cancer sfum05207   Chemical carcinogenesis - receptor activation sfum05218   Melanoma sfum05224   Breast cancer sfum05226   Gastric cancer Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130042343 (FGF2)    04014 Ras signaling pathway     130042343 (FGF2)    04015 Rap1 signaling pathway     130042343 (FGF2)    04020 Calcium signaling pathway     130042343 (FGF2)    04151 PI3K-Akt signaling pathway     130042343 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     130042343 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130042343 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     130042343 (FGF2)    05205 Proteoglycans in cancer     130042343 (FGF2)    05207 Chemical carcinogenesis - receptor activation     130042343 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     130042343 (FGF2)    05218 Melanoma     130042343 (FGF2)    05224 Breast cancer     130042343 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     130042343 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     130042343 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfum04052]     130042343 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:sfum00536]     130042343 (FGF2) Cytokines and neuropeptides [BR:sfum04052]  Cytokines   Growth factors (RTK binding)    130042343 (FGF2) Glycosaminoglycan binding proteins [BR:sfum00536]  Heparan sulfate / Heparin   Growth factors/receptors    130042343 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 Fascin Motif Other DBs NCBI-GeneID:  130042343 NCBI-ProteinID:  XP_055990479 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MASGAVSTLPDGGAFPPGHFRDPKRLYCKNGGFFLRIHPDGRVDGAREKSDPHVKLQLQA EERGVVSIKGVSANRYLAMKDDGRLLALKCVTDECFFLERLESNNYNTYRSRKYSGWYVA LKRTGQCKLGPRTGPGQKAILFLPMSARS NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcctcgggcgccgtgtccacgctgcccgacggcggcgccttcccgcccggccacttc agggaccccaagcggctctactgcaagaacgggggcttcttcctgcgcatccaccccgac ggccgcgtggacggggcgcgcgagaagagcgacccccacgtcaagctgcagctgcaggct gaggagcgaggggtcgtgtccatcaagggcgtgagcgccaaccgctacctggccatgaag gacgatggacggctgctggctctgaaatgcgtgacggacgagtgcttcttcctggagcgg ctggagtccaacaactacaacacctaccgctcgcgcaagtactcgggctggtacgtggcc ctcaagcgcaccgggcagtgcaagctggggccccggacgggcccggggcagaaggccatc ctgttcctccccatgtcggccaggagctga

DBGET integrated database retrieval system