KEGG   Streptomyces genisteinicus: IAG43_27160
Entry
IAG43_27160       CDS       T07903                                 
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
sgj  Streptomyces genisteinicus
Pathway
sgj00909  Sesquiterpenoid and triterpenoid biosynthesis
sgj00998  Biosynthesis of various antibiotics
sgj01100  Metabolic pathways
sgj01110  Biosynthesis of secondary metabolites
Module
sgj_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sgj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    IAG43_27160
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    IAG43_27160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sgj00199]
    IAG43_27160
Enzymes [BR:sgj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     IAG43_27160
Cytochrome P450 [BR:sgj00199]
 Cytochrome P450, bacteria type
  CYP183 family
   IAG43_27160
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QNP66249
UniProt: A0A7H0I0D3
LinkDB
Position
6309995..6311389
AA seq 464 aa
MTEQTTFSVGAAPGALPVVGHALQMMRHPVNFMTSLSAHGDLVEIRIGPTTAWVPTHPEL
LRHVLTNDRVFDKGGVFYDRARDIAGNGLVTCPFADHRRQRRLMQSAFTRGQLKRYAAAM
HAEIEETASRWQDGMVVDAFQEMYGMALRTVGRTLYSMPVSPELTAKVERSFDVVLNGLF
RQMFLPASIRRLPLPSQRRYKSNLAFLHETTQQLIDDYRSAGTERDDLLAALIASRDDDG
GRLGDQEIHDQVITVMAAGTETVAGTLTWVFYLLSQHPEIEAALYDEIDTVLEGRAPQWD
DLPNLSLADRIISEALRLHPPAWLFTRLTTAPTEVAGRELPTGSTVVFSPAAVAQYEDAF
ENPGTFDPDRWLPDRIAPASRHAFVPFGTGARKCIGDLYARTEATLGLATILGRWRVTCE
PGMDIRPVPLATVYHPRRLRLRLDARTPRPVTSAVPAPAGGDAA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaccgagcagacgaccttctcggtgggagcggcgcccggcgcgctccccgtcgtggga
cacgccctgcagatgatgcgccaccccgtgaacttcatgacctccctgtcggcccacggc
gacctggtcgagatcaggatcggccccaccacggcctgggtcccgacccatcccgaactg
ctgcggcacgtcctgaccaacgaccgcgtgttcgacaagggcggcgtcttctacgaccgc
gcccgtgacatcgccggcaacggcctggtcacctgcccgttcgcggaccaccgccgccag
cgccggctgatgcagtcggcgttcacccgcggccagctcaagcggtacgccgccgccatg
cacgccgagatcgaggagacggcgtcgcgctggcaggacggcatggtcgtggacgccttc
caggagatgtacggcatggcgctgcgcacggtcggccgcaccctgtactccatgcccgtc
agccccgagctgacggccaaggtggaacgttccttcgatgtcgtgctcaacggcctgttc
cggcagatgttcctgccggcctcgatccgccggctccccctgccctcccagcgccgctac
aagagcaacctggccttcctgcacgagaccacccagcagctcatcgacgactaccgcagc
gccggcaccgagcgcgacgacctgctcgccgccctgatcgcctcgcgcgacgacgacggc
ggccggctcggcgaccaggagatccacgaccaggtcatcaccgtcatggcggccggcacc
gagaccgtcgccggcaccctcacctgggtcttctacctcctctcccagcacccggagatc
gaggccgcgctctacgacgagatcgacaccgtcctggagggccgcgccccgcagtgggac
gacctgccgaacctctcgctggccgaccggatcatctccgaggcgctgcgactgcacccg
ccggcctggctgttcacgcgcctcaccaccgccccgaccgaagtggcgggccgggagctg
cccaccggctccaccgtcgtcttcagccccgccgcggtcgcccagtacgaggacgccttc
gagaaccccgggacgttcgaccccgaccgctggctcccggaccgcatcgcgcccgcctcc
cgccacgccttcgtgccgttcggcaccggtgcgcgcaagtgcatcggcgacctctacgca
cgcaccgaggccaccctgggcctcgccaccatcctcggccgctggcgggtcacctgcgag
cccggcatggacatccgcccggtcccgctggccaccgtctaccacccgcgccgactgcgc
ctgaggctggacgcgcgcaccccgcgtcccgtgacctccgccgtccccgcaccggccggg
ggtgacgcggcgtga

DBGET integrated database retrieval system