Sphingomonas glaciei: M1K48_12220
Help
Entry
M1K48_12220 CDS
T08593
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
sglc
Sphingomonas glaciei
Pathway
sglc03030
DNA replication
sglc03410
Base excision repair
sglc03420
Nucleotide excision repair
sglc03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
sglc00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
M1K48_12220 (ligA)
03410 Base excision repair
M1K48_12220 (ligA)
03420 Nucleotide excision repair
M1K48_12220 (ligA)
03430 Mismatch repair
M1K48_12220 (ligA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
sglc03032
]
M1K48_12220 (ligA)
03400 DNA repair and recombination proteins [BR:
sglc03400
]
M1K48_12220 (ligA)
Enzymes [BR:
sglc01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
M1K48_12220 (ligA)
DNA replication proteins [BR:
sglc03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
M1K48_12220 (ligA)
DNA repair and recombination proteins [BR:
sglc03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
M1K48_12220 (ligA)
NER (nucleotide excision repair)
GGR (global genome repair) factors
M1K48_12220 (ligA)
MMR (mismatch excision repair)
DNA ligase
M1K48_12220 (ligA)
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
M1K48_12220 (ligA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
DNA_ligase_ZBD
HHH_5
Nlig-Ia
HHH
PTCB-BRCT
YiiM_3-alpha
DZR_2
5_3_exonuc
Motif
Other DBs
NCBI-ProteinID:
UUR07683
UniProt:
A0ABY5MX18
LinkDB
All DBs
Position
complement(2484771..2486795)
Genome browser
AA seq
674 aa
AA seq
DB search
MTEAEAGRRLRQLAKEIARHNRLYHDADAPEISDADYDALIRENNELEAAFPHLIRADSP
NAVVGAAPSSALTKVTHARPMLSLDNAFSAEDVHDFVRRARRFLSLSEDQPVALTAEPKI
DGLSCSLRYESGTLVLAATRGDGTIGEDVTPNVRTIADIPQQLTGAPDVLEVRGEVYMSK
ADFAALNERQQASGGKVFANPRNGAAGSLRQKDPAITAARPLRFLLHGWGELSEPLGATQ
SEALDRLRALGFPIDERVVRCADADAALAHYAAIEHARADLPFDIDGVVYKLDRLDWQER
LGFVGRAPRWAIAHKFPAEKAETTLERIKIQVGRTGKLTPIGRLTPVGVGGVIVSNVTLH
NRDEIARLGLREGDRVRIQRAGDVIPQVVENLTRDEEREAFVYPDHCPACGSEAVAEDGE
VDIRCTGGLVCPAQRLERLKHFVSRGAMDIEGLGEKTIVKFADLGWIEKPSDIFRLAAHR
AELLGREGWKEKSVDALLAAIEARKGFDSARLLFGLGIRHVGIVTARDLLKCFGTIDAIQ
AAALDEHGTAELSAVDGVGPVVAEAVHDFFHEPHNREEVAALLRLAAPAPFVSQARETEW
SGKTIVFTGSLETMSRDEAKAQAERLGARAAGSVSAKTDLVVAGRGAGSKLKKAEELGIR
VATEEEWARIVAKA
NT seq
2025 nt
NT seq
+upstream
nt +downstream
nt
atgaccgaagccgaagccggtcgccgcctgcgccaactggccaaggagatcgcgcgccac
aaccgcctctatcacgatgctgacgcgcccgagatcagcgacgccgactatgacgcactg
atccgcgagaacaatgaactcgaagccgccttcccacacctgatccgcgccgattcgccc
aatgccgtggtcggcgccgcgccttcttcggccctgaccaaggtcacccatgctcggccg
atgctgagcctggacaacgccttcagcgccgaggacgtccacgacttcgtccgccgcgcg
cgccgcttcctcagcctgtccgaggaccagccggtcgcgctcaccgccgaacccaagatc
gacggcctgtcctgctctctccgctacgaaagcggcacgctggtgctggccgccacccgc
ggcgacggcacgataggtgaggacgtcactcccaacgtccgcaccatcgccgatattccc
cagcagctgaccggcgcgcccgacgtgctggaggtgcgcggcgaggtctacatgtccaag
gccgacttcgccgccctgaacgagcgccagcaggcaagcggcggcaaggtcttcgccaac
ccccgcaacggcgccgccggctcgctccgtcagaaggaccccgcgatcaccgccgcccgc
cccctgcgcttcctgctccacggctggggtgaattgtcggagccgctcggcgcgacgcaa
agcgaggctctcgaccgcctccgcgcgctcggcttcccgatcgacgagagggtcgtgcgc
tgcgccgacgccgacgccgccctcgcccattatgccgccattgaacacgcccgcgccgac
ttgccgttcgacatcgacggcgtcgtctacaagctcgaccgcctcgactggcaggagcgc
ctcggcttcgtcggccgcgccccgcgctgggcgatcgcccataaattccctgccgaaaag
gccgaaaccacgcttgagcggatcaagatccaggtcggccgcaccggcaaattgaccccg
atcggccgcctgacaccggtcggcgtcggcggggtcatagtcagcaacgtcaccctccac
aaccgcgacgagatcgcacgcctcggcctgcgcgaaggcgaccgagtccgcatccagcgc
gccggcgacgtcattccgcaggtggtggaaaatcttacccgcgacgaagagcgcgaggcc
ttcgtctaccccgaccactgccccgcctgcggctccgaagccgtcgccgaggacggcgag
gtcgacatccgctgcaccggcggcctggtctgccccgcccagcggctcgagcgcctcaag
catttcgtcagccgcggggcgatggacatcgaggggctgggcgaaaagaccatcgtcaaa
ttcgccgacctcggctggatcgagaagccgtccgacatcttccgccttgcagcacaccgc
gccgaactgctcggccgcgaggggtggaaggaaaagagcgtcgacgccctcctcgccgcg
atcgaggcgcgcaagggcttcgacagcgcccgcctgctgttcggcctcggcatccgccac
gtcggtatcgtcaccgcccgcgatctgctgaaatgcttcggcacgatcgacgcaattcag
gcggcggcgctggacgagcacggcaccgccgaactctccgcggtcgacggcgtcggcccg
gtcgtcgccgaagccgtccacgacttcttccacgaaccccacaaccgcgaggaagtcgcc
gccctcttgcggctcgcggcccccgccccgttcgtcagccaggcccgcgagaccgaatgg
agcggcaagaccatcgtcttcaccggcagcctcgaaaccatgagccgcgacgaagccaag
gcccaggccgaacgcctcggggcaagggcggcgggaagcgtcagcgccaagaccgaccta
gtggtggcgggccgcggcgccggctccaagctcaagaaagccgaagaactcggcatccgc
gtcgccaccgaagaggagtgggcgaggattgtggcgaaggcctga
DBGET
integrated database retrieval system