Streptomyces griseus: SGR_2441
Help
Entry
SGR_2441 CDS
T00691
Name
(GenBank) putative short chain dehydrogenase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
sgr
Streptomyces griseus
Pathway
sgr00061
Fatty acid biosynthesis
sgr00780
Biotin metabolism
sgr01100
Metabolic pathways
sgr01110
Biosynthesis of secondary metabolites
sgr01212
Fatty acid metabolism
sgr01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
sgr00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
SGR_2441
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
SGR_2441
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
SGR_2441
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
sgr01004
]
SGR_2441
Enzymes [BR:
sgr01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
SGR_2441
Lipid biosynthesis proteins [BR:
sgr01004
]
Fatty acid synthase
Component type
SGR_2441
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
NAD_binding_10
3HCDH_N
Epimerase
TPP_enzyme_N
F420_oxidored
Shikimate_DH
Motif
Other DBs
NCBI-ProteinID:
BAG19270
Kitasato:
SGR2441
UniProt:
B1W1P5
LinkDB
All DBs
Position
2879725..2880516
Genome browser
AA seq
263 aa
AA seq
DB search
MVTETDWRRRSVVVTGATRGIGRGIAELFARRGAAVVVTGREEETARAVADELARVTGSR
VAGLGVDLRDPGAIEAMAHEAEARHGHVDVVCANAGIFPEKSLREMTAADVDDVLAVNLR
GSILTTKAFLPAMERAGHGRVVLTSSITGPTTGYGGWSHYGASKAGQLGFLRSAALELAP
AGITVNAVLPGNVRTEGLSKLGEDYLRRMAATIPAGRLGETADIAHAVLFLASDEASFVT
GQTLTVDGGQTLPESLDSFVPLA
NT seq
792 nt
NT seq
+upstream
nt +downstream
nt
atggtgacggagaccgattggcgacggcggtccgtggtcgtgacgggcgcgacgcggggc
atcgggcggggcatcgcggaactgttcgcccgtcgcggggccgctgtcgtcgtcacgggg
cgggaggaggagaccgcccgcgccgtggcggacgaactcgcgcgggtcaccggatcccgg
gttgccgggctgggtgtggatctccgggacccgggagcgatcgaggcgatggctcacgag
gccgaggcgcgccacgggcatgtggacgtggtgtgcgcgaacgccgggatcttccccgag
aagtccctgagggagatgacggccgcggacgtggacgacgtcctcgccgtcaacctgcgg
ggctcgatcctgacgacgaaggcgttcctgccggccatggagcgcgcggggcacggacgc
gtggtgctcacctcctcgatcaccgggccgaccacgggttacggcgggtggtcgcactac
ggggcgagcaaggcgggccagttgggattcctgcggagcgccgcactcgaactggccccg
gcgggaatcaccgtcaacgccgtcctgccgggaaacgtccgcaccgaggggctgagcaag
ctgggtgaggactacctgcgccgcatggccgccacgatcccggcgggccggctcggcgag
accgcggacatcgcccacgccgtgctgttcctcgcctccgacgaggcctcgttcgtcacg
ggtcagacgctcaccgtcgacggcggccagaccctgccggagtcgctggactccttcgtc
ccgctcgcctga
DBGET
integrated database retrieval system