Schistocerca gregaria (desert locust): 126315376 Help Entry 126315376         CDS       T08688                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sgre  Schistocerca gregaria (desert locust) Pathway sgre03420   Nucleotide excision repair sgre04120   Ubiquitin mediated proteolysis sgre04141   Protein processing in endoplasmic reticulum sgre04310   Wnt signaling pathway sgre04341   Hedgehog signaling pathway - fly sgre04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sgre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126315376    04120 Ubiquitin mediated proteolysis     126315376   09124 Replication and repair    03420 Nucleotide excision repair     126315376  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     126315376    04341 Hedgehog signaling pathway - fly     126315376    04350 TGF-beta signaling pathway     126315376  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sgre04121]     126315376    03400 DNA repair and recombination proteins [BR:sgre03400]     126315376 Enzymes [BR:sgre01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      126315376 Ubiquitin system [BR:sgre04121]  Ubiquitin ligases (E3)   UBL E3 ligases    126315376   Multi subunit type E3    SCF complex     Ring finger protein      126315376    Cul2 complex      126315376    Cul3 complex      126315376    Cul4 complex      126315376    Cul7 complex      126315376    Cul8 complex      126315376    Cul9 complex      126315376 DNA repair and recombination proteins [BR:sgre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       126315376     TCR (transcription coupled repair) factors      Cul4-CSA complex       126315376 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 VSP zf-C3HC4_2 PHD_NSD Motif Other DBs NCBI-GeneID:  126315376 NCBI-ProteinID:  XP_049848587 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MILSEIRHFSMESSIAQEPPKINNDEEIKKSAKKHKSEKRFEVKKWNAVALWSWDIAVDN CAICRNNIMDFCIECQANQQSTTTEECTVAWGICNHAFHFHCISKWLRTRKVCPLDNKDW EFQRYGK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgattttgtctgagatccggcattttagtatggagtcatcaatcgctcaagaacctcca aaaatcaacaacgacgaagaaataaaaaaatctgccaagaagcataagagcgaaaagagg ttcgaagtgaagaaatggaatgctgtagctttatggtcttgggacatagctgtagataac tgcgctatatgccgcaataacatcatggatttttgcattgagtgtcaagctaatcagcaa tctacgacaaccgaagagtgtacagtagcatggggtatctgtaatcacgcttttcacttt cactgtatctcaaaatggctgaggacacgcaaggtttgccctctagataataaggactgg gagttccaaagatatggaaagtga

DBGET integrated database retrieval system