Staphylococcus haemolyticus JCSC1435: SH1480 Help Entry SH1480            CDS       T00250                                  Symbol dfrA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism sha  Staphylococcus haemolyticus JCSC1435 Pathway sha00670   One carbon pool by folate sha00790   Folate biosynthesis sha01100   Metabolic pathways sha01240   Biosynthesis of cofactors sha04981   Folate transport and metabolism Module sha_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sha00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SH1480 (dfrA)    00670 One carbon pool by folate     SH1480 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     SH1480 (dfrA) Enzymes [BR:sha01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      SH1480 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  BAE04789 UniProt:  Q4L6D6 LinkDB All DBs Position 1521285..1521764 Genome browser AA seq 159 aa AA seqDB search MTLSILVAHDEQRVIGYNNDLPWHLPNDLKHVKKLSTGNTLVMGRRTFESIGKPLPNRRN VVLTSDTTFNVDGVDVIHSIDDIYKLEGHIFIFGGQSLFEEMIDKVDDMYITVVNGKHQG DTFFPPYTFEEWEVESSVDGELDEKNTIPHTFLHLVRKH NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgactttatcaattttggtagcacatgatgaacaacgcgttattggatataataatgat ttaccatggcatttacctaatgatttgaaacatgttaaaaaattatcaactggaaacacg ctagtgatggggagaagaacatttgagtcaattggtaaaccgcttcctaacagaagaaat gtagtgttaacgagtgacacaacgtttaacgttgatggtgtagatgtgattcattctata gatgatatttacaaattagaaggtcatatttttatctttggtggtcagtcattatttgaa gaaatgattgataaagtagatgatatgtacattactgttgttaatggtaaacaccagggc gatacatttttcccaccttatacttttgaagaatgggaagtagagtcatcggtagacgga gagttagatgagaaaaatacaattccacatacgtttttacatttagtacgtaaacattaa

DBGET integrated database retrieval system