Strigops habroptila (Kakapo): 115603406 Help Entry 115603406         CDS       T08851                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism shab  Strigops habroptila (Kakapo) Pathway shab03260   Virion - Human immunodeficiency virus shab03264   Virion - Flavivirus and Alphavirus shab03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus shab03273   Virion - Lassa virus and SFTS virus shab04145   Phagosome shab04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:shab00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     115603406    03264 Virion - Flavivirus and Alphavirus     115603406    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     115603406    03273 Virion - Lassa virus and SFTS virus     115603406  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     115603406  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115603406  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shab04131]     115603406   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:shab04054]     115603406    04515 Cell adhesion molecules [BR:shab04515]     115603406    04090 CD molecules [BR:shab04090]     115603406    04091 Lectins [BR:shab04091]     115603406 Membrane trafficking [BR:shab04131]  Endocytosis   Phagocytosis    C-lectin receptors     115603406 Pattern recognition receptors [BR:shab04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    115603406 Cell adhesion molecules [BR:shab04515]  Lectins   Selectins and C-type lectins    115603406 CD molecules [BR:shab04090]  Proteins   115603406 Lectins [BR:shab04091]  C-Type lectins   Asialoglycoprotein and DC receptors    115603406 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  115603406 NCBI-ProteinID:  XP_030331110 UniProt:  A0A672UYZ3 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MDEEHLHDDLHDFKDRNFFRLKLRSFATVYLLLALSFLLIFTLFAVSLSRVSAISSKLQE VPLEQRHNISGRDFLLFPCGPRSREWEYFDGKCYYFSLTRTSWHKAKAQCEEMHSQLAVI NSYAKQNFVMFRTRNERFWIGLTDENSEGEWEWVDGTDYKTTFTFWKEGEPNNSGSNEDC AHVWGSGKWNDVYCTYECYYICEKPVPK NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggatgaggaacatcttcatgatgatctgcacgattttaaagacagaaacttcttcagg ctgaagctgaggtcctttgccacagtctacttgctgctggccctctccttcctgctcatc ttcaccctctttgctgtgtcactctccagagtttcagccatttcttctaagctccaggag gtgcccctggagcagagacacaacatttcgggcagggattttctcttgtttccctgcgga cccagatccagggaatgggaatactttgatggaaaatgttactacttctccctcaccaga acgagctggcacaaggcgaaggctcagtgcgaggagatgcactcgcagctcgctgtcatt aacagctatgccaagcagaattttgtcatgttcaggacaaggaatgagcgtttctggatc gggctcacggatgagaactcagaaggggaatgggaatgggtggacgggaccgactacaaa accacgttcacattttggaaggagggagagcccaataacagcggcagcaatgaggattgt gcccatgtctgggggtcagggaagtggaacgatgtctactgcacctacgagtgctactac atctgcgagaagcctgtgcccaagtga

DBGET integrated database retrieval system