Strigops habroptila (Kakapo): 115608651 Help Entry 115608651         CDS       T08851                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism shab  Strigops habroptila (Kakapo) Pathway shab04060   Cytokine-cytokine receptor interaction shab04672   Intestinal immune network for IgA production shab04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:shab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115608651 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     115608651 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     115608651 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shab04052]     115608651 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:shab00536]     115608651 (CXCL12) Cytokines and neuropeptides [BR:shab04052]  Cytokines   Chemokines    115608651 (CXCL12) Glycosaminoglycan binding proteins [BR:shab00536]  Heparan sulfate / Heparin   Chemokines    115608651 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  115608651 NCBI-ProteinID:  XP_030343669 UniProt:  A0A672TPW3 LinkDB All DBs Position 5:complement(63722075..63740425) Genome browser AA seq 131 aa AA seqDB search MDLRALALLAFALAILSLSEEKPVSLTYRCPCRFYESNVARANIKHLKILSTPNCSLQIV ARLKSNSKQVCIDPKLKWIQEYLEKALNKPRHRTHKKKQQKKRGPLCPSRATPLKSPGRK NGGSRCKRQAL NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggacctccgcgctctagctctgctcgccttcgccctggccatcctctccctgtcggag gagaaaccggtcagcctgacttaccgatgcccctgtcgattctacgagagcaacgtggca agagccaacattaagcacctcaaaatcctctctacacccaactgctcacttcagattgtt gcaaggctcaagagcaacagcaagcaagtgtgcattgatcccaagttaaagtggatccag gaatatctggagaaagctttaaacaaaccacgtcatcgcactcataaaaaaaagcaacag aagaaacggggcccactctgcccttcccgtgcaacaccactaaagtctccagggagaaag aatggaggttcaagatgtaagaggcaagcattgtaa

DBGET integrated database retrieval system