Strigops habroptila (Kakapo): 115614736 Help Entry 115614736         CDS       T08851                                  Symbol RAN Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism shab  Strigops habroptila (Kakapo) Pathway shab03008   Ribosome biogenesis in eukaryotes shab03013   Nucleocytoplasmic transport shab03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:shab00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     115614736 (RAN)    03008 Ribosome biogenesis in eukaryotes     115614736 (RAN)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     115614736 (RAN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:shab03019]     115614736 (RAN)    03009 Ribosome biogenesis [BR:shab03009]     115614736 (RAN)    03016 Transfer RNA biogenesis [BR:shab03016]     115614736 (RAN)    03036 Chromosome and associated proteins [BR:shab03036]     115614736 (RAN)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shab04147]     115614736 (RAN)    04031 GTP-binding proteins [BR:shab04031]     115614736 (RAN) Messenger RNA biogenesis [BR:shab03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      115614736 (RAN) Ribosome biogenesis [BR:shab03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     115614736 (RAN)   Pre-60S particles     115614736 (RAN) Transfer RNA biogenesis [BR:shab03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     115614736 (RAN) Chromosome and associated proteins [BR:shab03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      115614736 (RAN)    Spindle formation proteins     115614736 (RAN) Exosome [BR:shab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115614736 (RAN) GTP-binding proteins [BR:shab04031]  Small (monomeric) G-proteins   Ran Family    Ran     115614736 (RAN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RNA_helicase G-alpha Pox_A32 AAA_24 ArgoMid Septin AAA_7 SRPRB TsaE AAA_16 DUF5906 AAA_22 Motif Other DBs NCBI-GeneID:  115614736 NCBI-ProteinID:  XP_030357850 UniProt:  A0A672UWA6 LinkDB All DBs Position 11:5756499..5765441 Genome browser AA seq 216 aa AA seqDB search MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIK FNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC GNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMP ALAPPEVVMDPALAAQYEQDLQIAQTTALPDEDDDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggccgcccagggagagccccaagtgcagtttaagcttgtcctagttggtgacggtggc actggtaaaacaacatttgtaaaacgtcatttgactggtgaatttgaaaagaagtatgta gcaacgctgggtgttgaagttcatcctctggtgttccatactaacagaggccctattaaa tttaatgtatgggacacagctggacaagagaaatttggtggtctgcgagatggctattac atccaagctcagtgtgccatcataatgtttgatgtaacatcaagagttacttacaagaat gtacctaattggcacagagatctggtacgagtatgtgaaaacatccctatagtgttgtgt ggcaacaaagtggatattaaggacagaaaagtcaaggccaagtccattgtcttccacagg aagaagaatctccagtattatgacatttcggctaagagtaactacaactttgagaagcct ttcctctggcttgctagaaagctaattggagatcctaacttggagtttgttgccatgcct gctcttgcaccacctgaagttgttatggacccagcactggcagcacagtatgagcaagac ttacagattgctcaaaccactgcactgccagatgaagatgatgacctgtga

DBGET integrated database retrieval system