KEGG   Streptomyces harbinensis: HUT13_24910
Entry
HUT13_24910       CDS       T07389                                 
Name
(GenBank) SRPBCC family protein
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
shar  Streptomyces harbinensis
Pathway
shar01056  Biosynthesis of type II polyketide backbone
shar01100  Metabolic pathways
shar01110  Biosynthesis of secondary metabolites
Module
shar_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:shar00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    HUT13_24910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shar01004]
    HUT13_24910
   01008 Polyketide biosynthesis proteins [BR:shar01008]
    HUT13_24910
Enzymes [BR:shar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     HUT13_24910
Lipid biosynthesis proteins [BR:shar01004]
 Polyketide synthase
  Component type
   HUT13_24910
Polyketide biosynthesis proteins [BR:shar01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C14 cyclized polyketide type
    Octaketide PKS
     HUT13_24910
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc Hyr1
Other DBs
NCBI-ProteinID: QKV71649
UniProt: A0A7H8H713
LinkDB
Position
5512846..5513781
AA seq 311 aa
MTTRHVEHEITVAVPARTVYSLIAEVGNWPRIFPPTLHVDQLERGPDHERIRIWATANGE
AKTWTSLRTLAPAELRITFRQEVSTPPVAAMGGTWIIEPLTSTTARVRLLHDYRAIDDDP
AGLAWIDKAVDSNSRSELAALRDNVELAHSAADLTFSFEDSVRISGSAKDAYDFVNEAGR
WAERLPHVASVHFAEDTPGLQTLAMETRAKDGSTHTTKSYRVTFPHHRIAYKQVTLPPLM
SLHTGCWTFTETDGAVTATSGHTVVLNPGNITRVLGPAAGIAEARTYVRSALSTNSRATL
GYAKDYAENRG
NT seq 936 nt   +upstreamnt  +downstreamnt
atgacgacccggcacgtcgaacacgagatcaccgtcgcggtcccggcccgcaccgtctac
tccctgattgcggaagtcggcaactggccccggatcttcccgcccaccctgcacgtggac
cagctggagcgcggtccggaccatgagcgcatccggatctgggcgaccgccaacggtgag
gccaagacctggacctccctccgtaccctggctccggcggaactgcggatcaccttccga
caggaggtctccaccccaccggtcgccgccatgggcggcacctggatcatcgagccgctg
accagcacgacggcccgggtcaggctgctccacgactaccgggccatcgacgacgacccg
gcgggcctggcctggatcgacaaggccgtcgacagcaactcgcgctccgaactggccgct
ctgcgggacaacgtggaactggcccactccgccgctgacctgactttctccttcgaggac
tcggtgcgcatcagcggctccgccaaggatgcctacgacttcgtcaacgaggcgggacgg
tgggccgaacggcttccgcacgtcgcctcggtgcacttcgcggaggacacccccgggttg
cagaccttggcgatggagacccgggccaaggacggctcgactcacaccacgaagtcctac
cgcgtgaccttcccccaccaccggatcgcctacaaacaggtcaccctgccgccgctgatg
tcactgcacaccggctgctggacgttcacggagaccgacggcgcggtgaccgccacctcc
gggcacacggtggtcctcaaccccggcaacatcacccgcgttctgggcccggccgccgga
atcgccgaagccaggacctatgtacgcagcgccctcagcaccaacagccgggcgaccctc
ggatacgccaaggactacgccgagaaccggggctga

DBGET integrated database retrieval system