Salmonella enterica subsp. enterica serovar Heidelberg B182: SU5_04216
Help
Entry
SU5_04216 CDS
T02011
Name
(GenBank) DNA ligase
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
shb
Salmonella enterica subsp. enterica serovar Heidelberg B182
Pathway
shb03030
DNA replication
shb03410
Base excision repair
shb03420
Nucleotide excision repair
shb03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
shb00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
SU5_04216
03410 Base excision repair
SU5_04216
03420 Nucleotide excision repair
SU5_04216
03430 Mismatch repair
SU5_04216
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
shb03032
]
SU5_04216
03400 DNA repair and recombination proteins [BR:
shb03400
]
SU5_04216
Enzymes [BR:
shb01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
SU5_04216
DNA replication proteins [BR:
shb03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
SU5_04216
DNA repair and recombination proteins [BR:
shb03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
SU5_04216
NER (nucleotide excision repair)
GGR (global genome repair) factors
SU5_04216
MMR (mismatch excision repair)
DNA ligase
SU5_04216
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
SU5_04216
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
RNA_ligase
Nlig-Ia
Motif
Other DBs
NCBI-ProteinID:
AFH47534
LinkDB
All DBs
Position
complement(4602149..4603834)
Genome browser
AA seq
561 aa
AA seq
DB search
MRLWKSMAWGILLWHSQSGALCPAWPPARAAEEIARLQQQLADWNDIYWKQGVSAVDDSV
YDQLSARLVQWQRCVGQDVSSTPVSPPLNGTTMHPVAHTGVRKLADRQAVEQWMRGRSEL
WVQPKVDGVAVTLVYQNGKLARAISRGNGLQGEDWTPKIRLIPSIPQSTQGALANAVLQG
EIFLQREGHIQQRMGGMNARSKVAGMLMRQDNASALNSLGIFIWAWPDGPANMPERLSQL
AKAGFSLTKKYSLVVKDASEVERARQSWLTSALPFVTDGVVIRMAKEPASQYWRPGQGDW
LAAWKYPPVAQVAQVSAIQFSVGKSGKITVVASLVPVILDDKRVQRVNIGSVKRWEAWDI
APGDQILVSLAGQGIPRLDEVVWRSRERSKPVPPDSHFNSLTCFYASETCQEQFISRLVW
LGSRSALGLDGMGEASWRALHQTHRFEHIFSWLALTSAQIANTPGFAKGKSEQIWRQFNL
ARRQPFTRWIMAMDIPLTQAALQASGDRSWEQLLMRTEQHWRQLPATGERRAGRVIDWRD
NPQIKTLSRWLAAQHIPGFGS
NT seq
1686 nt
NT seq
+upstream
nt +downstream
nt
atgagattatggaaaagtatggcgtggggaattttattgtggcattcgcagagtggggcg
ctttgcccggcctggccgccagcaagggccgctgaagaaatcgcccgtttacagcaacag
ctcgctgactggaatgacatctactggaaacaaggtgttagcgcggttgacgatagtgtg
tacgaccaactcagcgcaaggctggttcagtggcaacgctgtgttggtcaggatgtttca
tctactccggtttcaccgccgttaaacggtacaacaatgcaccctgttgcgcacacgggc
gtacgcaaactcgcggaccgacaggcggtagaacagtggatgcgcgggcgcagcgagctt
tgggtacaaccaaaagtggatggcgtagcggtaacactggtttatcaaaacggtaaactg
gccagggctatcagccggggtaacggactacaaggcgaggactggacgccaaaaattcgc
ctgatcccctctataccgcagtcaacacaaggcgcgcttgctaacgcggtgttgcagggc
gaaatctttctacagcgcgagggacatatccagcaacggatgggcgggatgaatgcgcgc
tcgaaagtcgcaggaatgttaatgcgccaggataacgcctccgcgctaaattcgttgggt
atttttatttgggcgtggccggacggtccggcaaatatgcccgaaagattaagccaactt
gctaaggctggattcagtctgacgaagaaatattccctggtggtaaaagatgccagcgag
gtcgagcgggcgcgccagtcatggctgacgtcagcgttgccctttgtgacggatggcgta
gtgatacgcatggctaaagaacccgcgtcacaatactggcgacccgggcagggcgactgg
ctggcagcatggaaatatccgccagtagcgcaggtcgcgcaagtgagcgctattcagttc
tcggtggggaaaagcggcaaaattaccgtagtagcgtcgcttgtccccgttatattggat
gataagcgggttcagcgggtcaatatcggttctgtgaaacgttgggaagcgtgggatatc
gcgccgggcgatcagatcctggtgagtctggcggggcaaggcattccccggcttgatgag
gtcgtctggcggagtcgtgagcggagtaagcctgtaccgcctgatagccatttcaactcg
ctgacctgcttttacgcgtcggaaacgtgtcaggaacagtttatctccaggctggtatgg
ctggggtcacggtcggcgttgggtctggacggaatgggcgaagccagctggcgggccttg
catcagacgcatcgctttgagcatatcttctcttggcttgccctgacgtcagcgcaaata
gccaacacgccaggctttgctaaaggaaaaagcgagcagatatggcggcaatttaacctg
gcgcgtcggcagccgtttacccgctggatcatggcgatggatatccccttaacgcaggcc
gcattacaggccagcggcgatcgctcatgggagcagttattaatgcgaacagagcaacac
tggcggcagttgccagcgacgggcgagcgccgtgccgggagagttatcgactggcgggat
aatccgcagatcaaaacgctgagcagatggctggctgctcagcatattcccggatttggg
tcttag
DBGET
integrated database retrieval system