Shewanella sp. H8: ABIS04_04555 Help Entry ABIS04_04555      CDS       T10623                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sheh  Shewanella sp. H8 Pathway sheh00790   Folate biosynthesis sheh01100   Metabolic pathways sheh01240   Biosynthesis of cofactors Module sheh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sheh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ABIS04_04555 (folB) Enzymes [BR:sheh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ABIS04_04555 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ABIS04_04555 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ABIS04_04555 (folB) SSDB OrthologParalogGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  XBJ49458 LinkDB All DBs Position 1038528..1038881 Genome browser AA seq 117 aa AA seqDB search MDKVLIRQLAIETVIGIYEWEKKLHQTLLIDLDMAWDNRLAAANDSYEQALCYETVSNRL TSLITEKPIELIETVAEMIAHCLQDEFNVPWVKVVVMKPGAIPHAASVGVEIERGSC NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggataaagtactcatacgtcagttagcgatagagaccgttatcggtatctatgaatgg gaaaaaaagcttcatcaaaccttgcttatcgatttggatatggcatgggataatcgcctt gctgcggccaacgatagttacgagcaggcattatgctatgaaacagtatcaaatcgatta acgtcattaattactgaaaagccgattgagttaattgaaactgtcgctgaaatgattgct cattgcctacaagatgaatttaatgtgccgtgggtaaaagtggtggtgatgaaacctggt gccattcctcatgcggcttcagtcggtgtagagattgaacgcggtagttgttaa

DBGET integrated database retrieval system