Salvia hispanica (chia): 125192207 Help Entry 125192207         CDS       T09851                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism shis  Salvia hispanica (chia) Pathway shis03420   Nucleotide excision repair shis04120   Ubiquitin mediated proteolysis shis04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:shis00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125192207    04120 Ubiquitin mediated proteolysis     125192207   09124 Replication and repair    03420 Nucleotide excision repair     125192207  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:shis04121]     125192207    03400 DNA repair and recombination proteins [BR:shis03400]     125192207 Enzymes [BR:shis01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      125192207 Ubiquitin system [BR:shis04121]  Ubiquitin ligases (E3)   UBL E3 ligases    125192207   Multi subunit type E3    SCF complex     Ring finger protein      125192207    Cul2 complex      125192207    Cul3 complex      125192207    Cul4 complex      125192207    Cul7 complex      125192207    Cul8 complex      125192207    Cul9 complex      125192207 DNA repair and recombination proteins [BR:shis03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       125192207     TCR (transcription coupled repair) factors      Cul4-CSA complex       125192207 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  125192207 NCBI-ProteinID:  XP_047945679 LinkDB All DBs Position 6:1950161..1952647 Genome browser AA seq 122 aa AA seqDB search MSTLDTDVNMVPAGEGSSGAGPSTTTPHSCKKSKKFEIKKWNAVSLWAWDIVVDNCAICR NHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtcgacactcgacaccgacgtcaacatggttccggccggagagggctcatccggcgcc ggcccttccactaccacgccgcactcctgcaagaaatcgaagaaattcgagattaaaaag tggaacgccgtctcgctttgggcttgggatatcgtggtcgataattgtgctatttgcagg aaccacatcatggatctatgcattgagtgccaggctaatcaagctagtgcgacgagcgag gaatgcacggttgcttggggggtttgcaaccatgctttccacttccattgcatcagcagg tggcttaagactcgccaagtttgtcctcttgacaacagcgagtgggagtttcagaagtat ggtcactag

DBGET integrated database retrieval system