Salvia hispanica (chia): 125193506 Help Entry 125193506         CDS       T09851                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism shis  Salvia hispanica (chia) Pathway shis00510   N-Glycan biosynthesis shis00513   Various types of N-glycan biosynthesis shis04141   Protein processing in endoplasmic reticulum Module shis_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:shis00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     125193506    00513 Various types of N-glycan biosynthesis     125193506  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125193506 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 TrbL_3 DUF6249 Motif Other DBs NCBI-GeneID:  125193506 NCBI-ProteinID:  XP_047947272 LinkDB All DBs Position 6:30132210..30134171 Genome browser AA seq 78 aa AA seqDB search MAPSGKPISSPVPDAWYPTLAVLLLAVGLAITAFFFIYEATSSRKNRNLAKELTTGAFAS VFLGFGSLFLLLSSGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcgccgtcagggaaaccgatctcaagcccagttccagatgcctggtaccccactctc gccgtacttctgctcgccgtcggccttgccatcaccgcctttttcttcatttatgaagct acttcctctaggaaaaatcgcaatcttgcaaaggaattgactactggtgcgtttgcatca gttttcctgggttttggatctctgttcttgctgctctcttctggtgtctatgtttga

DBGET integrated database retrieval system