Salvia hispanica (chia): 125209534 Help Entry 125209534         CDS       T09851                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism shis  Salvia hispanica (chia) Pathway shis03420   Nucleotide excision repair shis04120   Ubiquitin mediated proteolysis shis04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:shis00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125209534    04120 Ubiquitin mediated proteolysis     125209534   09124 Replication and repair    03420 Nucleotide excision repair     125209534  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:shis04121]     125209534    03400 DNA repair and recombination proteins [BR:shis03400]     125209534 Enzymes [BR:shis01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      125209534 Ubiquitin system [BR:shis04121]  Ubiquitin ligases (E3)   UBL E3 ligases    125209534   Multi subunit type E3    SCF complex     Ring finger protein      125209534    Cul2 complex      125209534    Cul3 complex      125209534    Cul4 complex      125209534    Cul7 complex      125209534    Cul8 complex      125209534    Cul9 complex      125209534 DNA repair and recombination proteins [BR:shis03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       125209534     TCR (transcription coupled repair) factors      Cul4-CSA complex       125209534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  125209534 NCBI-ProteinID:  XP_047965090 LinkDB All DBs Position 3:22686641..22689842 Genome browser AA seq 123 aa AA seqDB search MASLDTDVDMVPAGDGSSGAGPSTINPSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggcctcacttgataccgacgtcgatatggttcccgccggcgatggatcctccggcgcc gggccctccaccatcaatccctcatcgtccaccaagaaaccaaagcgattcgagatcaag aagtggaacgccgtctctctctgggcttgggatatcgtggtcgataattgtgccatttgc aggaatcatatcatggatctttgcattgagtgtcaggctaatcaggccagcgcaacaagc gaggaatgcacagttgcatggggtgtatgcaatcatgccttccacttccattgcattagc agatggctcaagacccgtcaagtttgtcctctggataatagcgagtgggagtttcagaag tatggtcactag

DBGET integrated database retrieval system