KEGG   Streptomyces huasconensis: J2N69_35800
Entry
J2N69_35800       CDS       T07920                                 
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
shk  Streptomyces huasconensis
Pathway
shk00909  Sesquiterpenoid and triterpenoid biosynthesis
shk00998  Biosynthesis of various antibiotics
shk01100  Metabolic pathways
shk01110  Biosynthesis of secondary metabolites
Module
shk_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:shk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    J2N69_35800
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    J2N69_35800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:shk00199]
    J2N69_35800
Enzymes [BR:shk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     J2N69_35800
Cytochrome P450 [BR:shk00199]
 Cytochrome P450, bacteria type
  CYP183 family
   J2N69_35800
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: UFQ19897
LinkDB
Position
complement(8054453..8055829)
AA seq 458 aa
MAQQTHQTEQQQTFVAGTAPGAVPLVGHAWQMMRRPLQFMSSLSRHGDLVKIRLGPTEAL
VPTHPALLRHVLTSDEEYDKGGIFYDRARDIAGNGLVTCPYADHRRQRRLMQSAFTRPQL
KRYASAMHAEIESSTERWSEGLVVDAFPEMYGMALRTVGRTLYSTPVSKELADSVERAFD
AVLKGLFRQMFLPAAVRKLPGPGNRRYRANLDYLHRTTQTLIDDYRRDGADHDDLLSALL
DSRDEDGGRLGDREIHDQVITVMAAGTETVAATLTWIFYLLSKYPRIERELYAEIDEVLA
GRAPEFDDVARLQLTDRIITETLRLYPPAWLFTRLTSTELDVAGVRLPAQSTVVFSPAAV
ALDAPSFPKERQFDPDRWLPDRVTPQARQSFMAFGTGARKCIGDLYARTEATLALATILS
KWRVTCEPGVDVRPVPLATVYQPRRLRLRLTARTPGTR
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcccagcagacccaccagaccgagcagcagcagaccttcgtcgcgggcaccgcaccg
ggagccgtgccactggtcggacacgcctggcagatgatgcgccgtccgctgcagttcatg
tcctcgctgtccaggcacggcgacctggtgaagatacgcctgggccctaccgaggccctc
gtaccgacccatcccgccctcctgcgccacgtcctgaccagcgacgaggagtacgacaag
ggcggcatcttctacgaccgcgcccgcgacatcgccggcaacggcctggtgacctgcccc
tacgccgaccaccggcggcagagaaggctcatgcagtcggcgttcacccgcccccagctc
aagcggtacgcgtcggccatgcacgccgagatcgagtcgagcacggaacgctggagcgag
ggactggtggtcgacgccttccccgagatgtacggcatggcgctgcgcaccgtgggccgc
acgctgtactcgacgccggtcagcaaggaactcgccgacagcgtggagcgcgccttcgac
gccgtgctcaagggtctcttccggcagatgttcctgcccgcggccgtacgcaagctgcct
ggtccgggcaaccggcgctaccgcgccaacctggactacctgcaccgcaccacccagacg
ctcatcgacgactaccgccgcgacggcgccgaccacgacgacctgctctccgccctcctc
gactcccgcgacgaggacggcggcaggctcggcgaccgggagatccacgaccaggtcatc
accgtgatggcggccggtaccgagacggtggcggccaccctcacctggatcttctacctg
ctctccaagtacccccggatcgagcgggaactgtacgcggagatcgacgaggtcctcgcg
ggccgggcaccggagttcgacgacgtcgcccggctccagctcaccgaccgcatcatcacc
gagaccctgcggctctacccgcccgcgtggctcttcacccggctgacctccaccgaactg
gacgtcgcgggggtgcggctgcccgcgcagagcacggtggtcttcagcccggccgcggtc
gcgctcgacgcgccctccttccccaaggagcgacagttcgaccccgaccgctggctgccc
gaccgggtgacgccgcaggcccgccagtcgttcatggcgttcggcaccggcgcccgcaag
tgcatcggcgacctctacgcccgcaccgaggcgaccctcgcgctcgccaccatcctcagc
aagtggcgggtcacctgcgaaccgggggtcgacgtgcgccccgtcccgctcgccaccgtg
taccagccgcgccgcctgcgcctgcggctgaccgcccgtacgccggggacgcggtga

DBGET integrated database retrieval system