Shewanella halifaxensis: Shal_1011 Help Entry Shal_1011         CDS       T00654                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism shl  Shewanella halifaxensis Pathway shl00790   Folate biosynthesis shl01100   Metabolic pathways shl01240   Biosynthesis of cofactors Module shl_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:shl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Shal_1011 Enzymes [BR:shl01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Shal_1011  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Shal_1011  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Shal_1011 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABZ75585 UniProt:  B0TIP0 LinkDB All DBs Position 1242344..1242697 Genome browser AA seq 117 aa AA seqDB search MDKVLIRELRIETVIGIYEWEKQIHQSLLIDLDMAWDNRLAAASDDYQHALCYETVSNRL TALITEKPIELIETVAEMIATCVMSEFNVPWVKVKVMKPGAVPTASAVGVEIERGYA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggataaagtactgattagagaacttagaattgaaaccgtcatcgggatctatgagtgg gaaaagcagatccaccagagcttgcttatcgatctagacatggcttgggataaccgctta gcggcggcaagtgatgattatcaacatgcactttgctatgagaccgtgtctaaccgcttg actgctttgatcactgaaaagccgatagagctgattgaaaccgtggctgaaatgattgcg acctgcgtgatgagtgaattcaatgtgccatgggtaaaagttaaggtgatgaaacccggc gctgtacctacagcgtctgcagtgggtgttgagattgaaagaggttatgcatag

DBGET integrated database retrieval system