Sturnira hondurensis: 118974748 Help Entry 118974748         CDS       T07222                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism shon  Sturnira hondurensis Pathway shon01522   Endocrine resistance shon01524   Platinum drug resistance shon04010   MAPK signaling pathway shon04071   Sphingolipid signaling pathway shon04110   Cell cycle shon04115   p53 signaling pathway shon04137   Mitophagy - animal shon04151   PI3K-Akt signaling pathway shon04210   Apoptosis shon04211   Longevity regulating pathway shon04216   Ferroptosis shon04218   Cellular senescence shon04310   Wnt signaling pathway shon04722   Neurotrophin signaling pathway shon04919   Thyroid hormone signaling pathway shon05012   Parkinson disease shon05014   Amyotrophic lateral sclerosis shon05016   Huntington disease shon05160   Hepatitis C shon05161   Hepatitis B shon05162   Measles shon05163   Human cytomegalovirus infection shon05165   Human papillomavirus infection shon05166   Human T-cell leukemia virus 1 infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05168   Herpes simplex virus 1 infection shon05169   Epstein-Barr virus infection shon05200   Pathways in cancer shon05202   Transcriptional misregulation in cancer shon05203   Viral carcinogenesis shon05205   Proteoglycans in cancer shon05206   MicroRNAs in cancer shon05210   Colorectal cancer shon05212   Pancreatic cancer shon05213   Endometrial cancer shon05214   Glioma shon05215   Prostate cancer shon05216   Thyroid cancer shon05217   Basal cell carcinoma shon05218   Melanoma shon05219   Bladder cancer shon05220   Chronic myeloid leukemia shon05222   Small cell lung cancer shon05223   Non-small cell lung cancer shon05224   Breast cancer shon05225   Hepatocellular carcinoma shon05226   Gastric cancer shon05230   Central carbon metabolism in cancer shon05417   Lipid and atherosclerosis shon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118974748 (TP53)    04310 Wnt signaling pathway     118974748 (TP53)    04071 Sphingolipid signaling pathway     118974748 (TP53)    04151 PI3K-Akt signaling pathway     118974748 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     118974748 (TP53)   09143 Cell growth and death    04110 Cell cycle     118974748 (TP53)    04210 Apoptosis     118974748 (TP53)    04216 Ferroptosis     118974748 (TP53)    04115 p53 signaling pathway     118974748 (TP53)    04218 Cellular senescence     118974748 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     118974748 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     118974748 (TP53)   09149 Aging    04211 Longevity regulating pathway     118974748 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118974748 (TP53)    05202 Transcriptional misregulation in cancer     118974748 (TP53)    05206 MicroRNAs in cancer     118974748 (TP53)    05205 Proteoglycans in cancer     118974748 (TP53)    05203 Viral carcinogenesis     118974748 (TP53)    05230 Central carbon metabolism in cancer     118974748 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     118974748 (TP53)    05212 Pancreatic cancer     118974748 (TP53)    05225 Hepatocellular carcinoma     118974748 (TP53)    05226 Gastric cancer     118974748 (TP53)    05214 Glioma     118974748 (TP53)    05216 Thyroid cancer     118974748 (TP53)    05220 Chronic myeloid leukemia     118974748 (TP53)    05217 Basal cell carcinoma     118974748 (TP53)    05218 Melanoma     118974748 (TP53)    05219 Bladder cancer     118974748 (TP53)    05215 Prostate cancer     118974748 (TP53)    05213 Endometrial cancer     118974748 (TP53)    05224 Breast cancer     118974748 (TP53)    05222 Small cell lung cancer     118974748 (TP53)    05223 Non-small cell lung cancer     118974748 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118974748 (TP53)    05161 Hepatitis B     118974748 (TP53)    05160 Hepatitis C     118974748 (TP53)    05162 Measles     118974748 (TP53)    05168 Herpes simplex virus 1 infection     118974748 (TP53)    05163 Human cytomegalovirus infection     118974748 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     118974748 (TP53)    05169 Epstein-Barr virus infection     118974748 (TP53)    05165 Human papillomavirus infection     118974748 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     118974748 (TP53)    05014 Amyotrophic lateral sclerosis     118974748 (TP53)    05016 Huntington disease     118974748 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118974748 (TP53)    05418 Fluid shear stress and atherosclerosis     118974748 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     118974748 (TP53)    01522 Endocrine resistance     118974748 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:shon03000]     118974748 (TP53)    03036 Chromosome and associated proteins [BR:shon03036]     118974748 (TP53)    03400 DNA repair and recombination proteins [BR:shon03400]     118974748 (TP53) Transcription factors [BR:shon03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     118974748 (TP53) Chromosome and associated proteins [BR:shon03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      118974748 (TP53) DNA repair and recombination proteins [BR:shon03400]  Eukaryotic type   Check point factors    Other check point factors     118974748 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  118974748 NCBI-ProteinID:  XP_036884277 LinkDB All DBs Position Unknown AA seq 398 aa AA seqDB search MEELKSEPQSEPVEPPMSQETFLQLWSLLHKNNVLTSEVSIAVGDDDLLLPPDLVNCLDK DPNEVPSMPATPTPVAALPAPPASPTPSTSPAQATSWPLSSCVPSQKTYPGSYDFHLGFL NSGTAKSVTCTYSSALNKLFCQLAKTCPVQLWVSSPPPPGTHVRAMAIYKKSEHMTEVVR RCPHHERCSDSSDGLAPPQHLIRVEGNSRAMYLEDKNTFRHSVLVPYETPEVGSDCTTIH YNFMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRIEEENFHKKG EACSKQPSGTNKRALPTNTDSSPPKMPVDGEYFLLKIRGHERFEMFRELNEALELKDAQA VKDPGESKTHHSHPKSKKGQSTPRHKKLMFKREGPDSD NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt atggaggagctaaagtcggagccacagtcggagcccgtggagcccccaatgagtcaggag acatttttacaattgtggagtctacttcacaaaaacaatgtcttgacttcagaggtgtcc atagcagtgggcgatgatgacctgctgctgcccccagaccttgtaaactgtctggacaaa gatccaaatgaagtccctagtatgccagcaactcctacaccagtagctgctctcccagca ccacctgcctccccaacaccatccacctccccagcacaagccacctcctggcccttgtca tcctgtgtcccttcccagaagacctaccctggtagctatgatttccatttaggattcctg aattctgggacagccaaatctgtaacctgcacgtactcctctgccctcaacaagttgttt tgccagctggcaaagacctgccccgtacaactgtgggtcagttctccacccccgcccgga acccatgtccgtgccatggccatttataagaagtctgagcacatgacagaggtcgtgagg cgctgcccccaccacgagcgctgctctgactctagtgatggtctggcccctcctcaacat cttatccgggtggaaggaaattcacgcgccatgtatttggaagacaaaaacacttttcga catagtgtgttggtgccctacgaaacacctgaggtgggctctgactgtaccaccatccac tacaacttcatgtgtaacagctcctgcatggggggcatgaatcggcggcccattctcacc atcatcacactagaagactccagtggtaatctgctgggacgggacagctttgaggtgcgt gtttgtgcctgtcctgggagagaccggcgcatagaggaagaaaatttccacaagaagggg gaggcttgttccaagcagccctctgggaccaataagcgagcactgcccaccaacaccgac tcctctccgccaaagatgccagtggatggagaatatttcctccttaagatccgtgggcat gaacgcttcgagatgttccgagaactaaatgaagccttagagttaaaggacgcccaggct gtaaaggacccaggggaaagcaagactcaccatagccacccgaagtctaaaaaggggcag tctactccccgccataaaaagctcatgttcaagagagaaggacctgattcagactga

DBGET integrated database retrieval system