Sturnira hondurensis: 118975891 Help Entry 118975891         CDS       T07222                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism shon  Sturnira hondurensis Pathway shon01522   Endocrine resistance shon04110   Cell cycle shon04115   p53 signaling pathway shon04151   PI3K-Akt signaling pathway shon04218   Cellular senescence shon04530   Tight junction shon04660   T cell receptor signaling pathway shon04933   AGE-RAGE signaling pathway in diabetic complications shon04934   Cushing syndrome shon05160   Hepatitis C shon05162   Measles shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05165   Human papillomavirus infection shon05166   Human T-cell leukemia virus 1 infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05169   Epstein-Barr virus infection shon05200   Pathways in cancer shon05203   Viral carcinogenesis shon05212   Pancreatic cancer shon05214   Glioma shon05218   Melanoma shon05219   Bladder cancer shon05220   Chronic myeloid leukemia shon05222   Small cell lung cancer shon05223   Non-small cell lung cancer shon05224   Breast cancer shon05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     118975891 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     118975891 (CDK4)    04115 p53 signaling pathway     118975891 (CDK4)    04218 Cellular senescence     118975891 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     118975891 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     118975891 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118975891 (CDK4)    05203 Viral carcinogenesis     118975891 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     118975891 (CDK4)    05225 Hepatocellular carcinoma     118975891 (CDK4)    05214 Glioma     118975891 (CDK4)    05220 Chronic myeloid leukemia     118975891 (CDK4)    05218 Melanoma     118975891 (CDK4)    05219 Bladder cancer     118975891 (CDK4)    05224 Breast cancer     118975891 (CDK4)    05222 Small cell lung cancer     118975891 (CDK4)    05223 Non-small cell lung cancer     118975891 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118975891 (CDK4)    05160 Hepatitis C     118975891 (CDK4)    05164 Influenza A     118975891 (CDK4)    05162 Measles     118975891 (CDK4)    05163 Human cytomegalovirus infection     118975891 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     118975891 (CDK4)    05169 Epstein-Barr virus infection     118975891 (CDK4)    05165 Human papillomavirus infection     118975891 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     118975891 (CDK4)    04934 Cushing syndrome     118975891 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     118975891 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:shon01001]     118975891 (CDK4) Enzymes [BR:shon01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      118975891 (CDK4) Protein kinases [BR:shon01001]  Serine/threonine kinases: CMGC group   CDK family    118975891 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  118975891 NCBI-ProteinID:  XP_036886002 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATLRYEPVAEIGVGAYGTVYKARDPNSGHFVALKSVRVPNGGGAGGGLPVSTVREVALL RRLEAFEHPNVVRLVDVCASSRTDRETRVTLVFEHVDQDLRTYLNKVPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPREPRPVQSVIPEMEESGAQLLLEMLTFNPLKRTSAFRALQHSYLQKAEG SPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacccttcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg tacaaggcccgtgatcccaacagtggccactttgtggccctcaagagcgtgagagtgccc aatggaggaggtgctggagggggccttcccgtcagcacagttcgtgaggtggccctgctg aggcggctggaagcttttgagcatcccaacgttgtcaggctggtggacgtctgtgccagc tcccggactgaccgggagaccagagtgaccctggtgtttgagcatgtggaccaagacctg aggacgtatctgaacaaggtacccccaccaggcttgccagtggagaccattaaggatctg atgcgtcagtttctaagaggcctggatttccttcatgccaactgcattgttcaccgggac ctaaagccagagaacattctggtgacaagtggtgggacagtcaagctggccgactttggc ttggccagaatctacagctaccagatggcactcacacctgtggttgttacactctggtac cgtgctccggaagttcttctgcagtcagcgtatgcaacacctgtggacttgtggagtgtt gggtgtatcttcgcagaaatgtttcgccgaaagcctcttttctgcggaaactctgaagct gaccaattaggcaaaatttttgatttgattgggctgcctcccgaggatgactggccccga gacgtgtctctgccccgaggagccttttcccccagagagccccgcccagtgcagtccgtg atacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca cttaagcgaacctcggccttccgagccctgcagcactcttatctacaaaaggcagaaggt agcccagagtga

DBGET integrated database retrieval system