Sturnira hondurensis: 118979386 Help Entry 118979386         CDS       T07222                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism shon  Sturnira hondurensis Pathway shon01521   EGFR tyrosine kinase inhibitor resistance shon01522   Endocrine resistance shon01524   Platinum drug resistance shon04064   NF-kappa B signaling pathway shon04066   HIF-1 signaling pathway shon04071   Sphingolipid signaling pathway shon04115   p53 signaling pathway shon04140   Autophagy - animal shon04141   Protein processing in endoplasmic reticulum shon04151   PI3K-Akt signaling pathway shon04210   Apoptosis shon04215   Apoptosis - multiple species shon04217   Necroptosis shon04261   Adrenergic signaling in cardiomyocytes shon04340   Hedgehog signaling pathway shon04510   Focal adhesion shon04621   NOD-like receptor signaling pathway shon04630   JAK-STAT signaling pathway shon04722   Neurotrophin signaling pathway shon04725   Cholinergic synapse shon04915   Estrogen signaling pathway shon04928   Parathyroid hormone synthesis, secretion and action shon04933   AGE-RAGE signaling pathway in diabetic complications shon05014   Amyotrophic lateral sclerosis shon05022   Pathways of neurodegeneration - multiple diseases shon05132   Salmonella infection shon05145   Toxoplasmosis shon05152   Tuberculosis shon05161   Hepatitis B shon05162   Measles shon05168   Herpes simplex virus 1 infection shon05169   Epstein-Barr virus infection shon05170   Human immunodeficiency virus 1 infection shon05200   Pathways in cancer shon05206   MicroRNAs in cancer shon05207   Chemical carcinogenesis - receptor activation shon05210   Colorectal cancer shon05215   Prostate cancer shon05222   Small cell lung cancer shon05226   Gastric cancer shon05417   Lipid and atherosclerosis shon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118979386 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     118979386 (BCL2)    04630 JAK-STAT signaling pathway     118979386 (BCL2)    04064 NF-kappa B signaling pathway     118979386 (BCL2)    04066 HIF-1 signaling pathway     118979386 (BCL2)    04071 Sphingolipid signaling pathway     118979386 (BCL2)    04151 PI3K-Akt signaling pathway     118979386 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118979386 (BCL2)   09143 Cell growth and death    04210 Apoptosis     118979386 (BCL2)    04215 Apoptosis - multiple species     118979386 (BCL2)    04217 Necroptosis     118979386 (BCL2)    04115 p53 signaling pathway     118979386 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     118979386 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118979386 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     118979386 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     118979386 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     118979386 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     118979386 (BCL2)    04722 Neurotrophin signaling pathway     118979386 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118979386 (BCL2)    05206 MicroRNAs in cancer     118979386 (BCL2)    05207 Chemical carcinogenesis - receptor activation     118979386 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     118979386 (BCL2)    05226 Gastric cancer     118979386 (BCL2)    05215 Prostate cancer     118979386 (BCL2)    05222 Small cell lung cancer     118979386 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118979386 (BCL2)    05161 Hepatitis B     118979386 (BCL2)    05162 Measles     118979386 (BCL2)    05168 Herpes simplex virus 1 infection     118979386 (BCL2)    05169 Epstein-Barr virus infection     118979386 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     118979386 (BCL2)    05152 Tuberculosis     118979386 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     118979386 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     118979386 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     118979386 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118979386 (BCL2)    05418 Fluid shear stress and atherosclerosis     118979386 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     118979386 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     118979386 (BCL2)    01524 Platinum drug resistance     118979386 (BCL2)    01522 Endocrine resistance     118979386 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:shon01009]     118979386 (BCL2) Protein phosphatases and associated proteins [BR:shon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      118979386 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  118979386 NCBI-ProteinID:  XP_036891314 LinkDB All DBs Position Unknown AA seq 231 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDASATAPGANPAPGIFSSQPGRTPAPA RTSPPPPAAPAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARG RFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTW IQDNGGWDAFVELYGPNMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 696 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgccgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgccggagacgcgagcgccacagccccg ggggccaaccccgcgccgggcatcttctcctcccagcccgggcgcacccccgcgcccgcc aggacctcgccgccgccccccgcagcccccgccgccgccgcggggcctgcgctcagcccc gtgccacccgtggtccacctgaccctgcgccaggccggcgacgacttctctcggcgctac cgccgggacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgagggga cgctttgccacggtggtggaggagctcttcagggatggggtgaactgggggaggattgtg gccttctttgaattcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgccc ctggtggacaacatcgccctgtggatgacggaatacctgaaccggcacctgcacacctgg atccaggataacggaggctgggacgcctttgtggagctgtatggccccaacatgcggccc ctctttgacttctcctggctgtccctgaaggcgctgctcagcctggccctggtgggcgcc tgcatcacgctgggggcctacctgggccacaagtga

DBGET integrated database retrieval system