Sturnira hondurensis: 118989641 Help Entry 118989641         CDS       T07222                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism shon  Sturnira hondurensis Pathway shon03050   Proteasome shon04060   Cytokine-cytokine receptor interaction shon04066   HIF-1 signaling pathway shon04217   Necroptosis shon04350   TGF-beta signaling pathway shon04380   Osteoclast differentiation shon04612   Antigen processing and presentation shon04630   JAK-STAT signaling pathway shon04650   Natural killer cell mediated cytotoxicity shon04657   IL-17 signaling pathway shon04658   Th1 and Th2 cell differentiation shon04659   Th17 cell differentiation shon04660   T cell receptor signaling pathway shon04940   Type I diabetes mellitus shon05140   Leishmaniasis shon05142   Chagas disease shon05143   African trypanosomiasis shon05144   Malaria shon05145   Toxoplasmosis shon05146   Amoebiasis shon05152   Tuberculosis shon05160   Hepatitis C shon05164   Influenza A shon05168   Herpes simplex virus 1 infection shon05200   Pathways in cancer shon05235   PD-L1 expression and PD-1 checkpoint pathway in cancer shon05321   Inflammatory bowel disease shon05322   Systemic lupus erythematosus shon05323   Rheumatoid arthritis shon05330   Allograft rejection shon05332   Graft-versus-host disease shon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     118989641 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     118989641 (IFNG)    04630 JAK-STAT signaling pathway     118989641 (IFNG)    04066 HIF-1 signaling pathway     118989641 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118989641 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118989641 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     118989641 (IFNG)    04612 Antigen processing and presentation     118989641 (IFNG)    04660 T cell receptor signaling pathway     118989641 (IFNG)    04658 Th1 and Th2 cell differentiation     118989641 (IFNG)    04659 Th17 cell differentiation     118989641 (IFNG)    04657 IL-17 signaling pathway     118989641 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     118989641 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118989641 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118989641 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     118989641 (IFNG)    05164 Influenza A     118989641 (IFNG)    05168 Herpes simplex virus 1 infection     118989641 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     118989641 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     118989641 (IFNG)    05144 Malaria     118989641 (IFNG)    05145 Toxoplasmosis     118989641 (IFNG)    05140 Leishmaniasis     118989641 (IFNG)    05142 Chagas disease     118989641 (IFNG)    05143 African trypanosomiasis     118989641 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     118989641 (IFNG)    05323 Rheumatoid arthritis     118989641 (IFNG)    05321 Inflammatory bowel disease     118989641 (IFNG)    05330 Allograft rejection     118989641 (IFNG)    05332 Graft-versus-host disease     118989641 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     118989641 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     118989641 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:shon03051]     118989641 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118989641 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:shon00536]     118989641 (IFNG) Proteasome [BR:shon03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     118989641 (IFNG) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Interferons    118989641 (IFNG) Glycosaminoglycan binding proteins [BR:shon00536]  Heparan sulfate / Heparin   Cytokines    118989641 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma API5 DUF7237 DUF7381 Motif Other DBs NCBI-GeneID:  118989641 NCBI-ProteinID:  XP_036905842 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MKYASYILAFQLFVILGSSSYFCKATFFSEVENLKEYLNATKSDVADNETLFLNVFKKWK DESDKKIFQSQIISFYFKLFDSLKDHQTIRSSVEVIKEDLRVKFFNSSNSKMEDFMKLIQ IPVNDLKFQRKAINELIRVRNELTPGSTLRKRRRSPKLFHARSASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatacgcaagttatatcttagcttttcagcttttcgtgattttgggttcttctagc tacttctgcaaggcgacgttttttagcgaagtagaaaaccttaaagaatatttaaatgca actaagtcggatgtagcagataatgagactctcttcttaaatgttttcaagaagtggaaa gacgagagtgacaaaaaaatatttcagagccaaattatctccttctacttcaaactcttt gactccttgaaagaccaccagaccattcggagcagtgtggaagtgatcaaggaagacctg cgtgtgaagttcttcaacagcagcaacagcaaaatggaggacttcatgaagctgattcaa attccagtaaatgatctgaagttccagcgcaaagcaataaatgaactcatcagagtgagg aatgagctgacaccaggatctaccctgaggaagcggagaaggagcccgaaactgtttcat gcccggagtgcctcaaaataa

DBGET integrated database retrieval system