Sturnira hondurensis: 118997990 Help Entry 118997990         CDS       T07222                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04151   PI3K-Akt signaling pathway shon04217   Necroptosis shon04380   Osteoclast differentiation shon04620   Toll-like receptor signaling pathway shon04621   NOD-like receptor signaling pathway shon04622   RIG-I-like receptor signaling pathway shon04623   Cytosolic DNA-sensing pathway shon04630   JAK-STAT signaling pathway shon04650   Natural killer cell mediated cytotoxicity shon04668   TNF signaling pathway shon04936   Alcoholic liver disease shon05135   Yersinia infection shon05142   Chagas disease shon05152   Tuberculosis shon05160   Hepatitis C shon05161   Hepatitis B shon05162   Measles shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05165   Human papillomavirus infection shon05167   Kaposi sarcoma-associated herpesvirus infection shon05168   Herpes simplex virus 1 infection shon05169   Epstein-Barr virus infection shon05170   Human immunodeficiency virus 1 infection shon05171   Coronavirus disease - COVID-19 shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     118997990    04668 TNF signaling pathway     118997990    04151 PI3K-Akt signaling pathway     118997990   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118997990  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118997990  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118997990    04621 NOD-like receptor signaling pathway     118997990    04622 RIG-I-like receptor signaling pathway     118997990    04623 Cytosolic DNA-sensing pathway     118997990    04650 Natural killer cell mediated cytotoxicity     118997990   09158 Development and regeneration    04380 Osteoclast differentiation     118997990  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     118997990    05161 Hepatitis B     118997990    05160 Hepatitis C     118997990    05171 Coronavirus disease - COVID-19     118997990    05164 Influenza A     118997990    05162 Measles     118997990    05168 Herpes simplex virus 1 infection     118997990    05163 Human cytomegalovirus infection     118997990    05167 Kaposi sarcoma-associated herpesvirus infection     118997990    05169 Epstein-Barr virus infection     118997990    05165 Human papillomavirus infection     118997990   09171 Infectious disease: bacterial    05135 Yersinia infection     118997990    05152 Tuberculosis     118997990   09174 Infectious disease: parasitic    05142 Chagas disease     118997990   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118997990   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118997990  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118997990 Cytokines and neuropeptides [BR:shon04052]  Cytokines   Interferons    118997990 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  118997990 NCBI-ProteinID:  XP_036917783 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MANAGIVQVALLLCFSTTALSMSYNVLQVQQRGSVSASWTLIWQLNGTLHNCLQDRMDFK FPKEVKLQKFQKEEAILVIHEMLQQIFDLFGRNFSSTGWNETIIEKLSEELSWQMDHLEP ALEKIMEEEKVTLKENTTLLHLKKYYLRIVQYLKAKLYSRCAWIVVRGHILKNFSVLYKL THFVFKN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccaatgcgggcatcgtccaggtggctctgctcttgtgtttctccaccacagctctt tccatgagctacaatgtgcttcaggtccaacagagaggcagtgtctcagcctcttggact ctcatatggcagttgaatggaacccttcacaattgcctccaggacagaatggacttcaag tttcccaaggaggttaaactacagaagttccagaaggaggaagccatactggtcatccat gagatgctccagcagatctttgatcttttcggaagaaatttctctagcacgggctggaat gagaccatcattgagaaactctctgaggaactcagttggcagatggaccatttggagcca gccctggagaaaatcatggaggaggaaaaggtcaccttgaaagaaaacaccaccctgtta cacctaaagaaatattacttaaggattgtacagtatctgaaggccaagttgtacagcaga tgtgcctggatagtagtgcgagggcacatcctcaagaacttttccgtcctttacaaactt acacattttgtcttcaaaaactga

DBGET integrated database retrieval system