Sturnira hondurensis: 118999084 Help Entry 118999084         CDS       T07222                                  Symbol CXCL1 Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04062   Chemokine signaling pathway shon04064   NF-kappa B signaling pathway shon04621   NOD-like receptor signaling pathway shon04657   IL-17 signaling pathway shon04668   TNF signaling pathway shon04936   Alcoholic liver disease shon05134   Legionellosis shon05146   Amoebiasis shon05167   Kaposi sarcoma-associated herpesvirus infection shon05323   Rheumatoid arthritis shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     118999084 (CXCL1)    04668 TNF signaling pathway     118999084 (CXCL1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118999084 (CXCL1)    04061 Viral protein interaction with cytokine and cytokine receptor     118999084 (CXCL1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118999084 (CXCL1)    04657 IL-17 signaling pathway     118999084 (CXCL1)    04062 Chemokine signaling pathway     118999084 (CXCL1)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     118999084 (CXCL1)   09171 Infectious disease: bacterial    05134 Legionellosis     118999084 (CXCL1)   09174 Infectious disease: parasitic    05146 Amoebiasis     118999084 (CXCL1)   09163 Immune disease    05323 Rheumatoid arthritis     118999084 (CXCL1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118999084 (CXCL1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118999084 (CXCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118999084 (CXCL1) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Chemokines    118999084 (CXCL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 DotU TPR_28 Motif Other DBs NCBI-GeneID:  118999084 NCBI-ProteinID:  XP_036919317 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MARTTTAAVHRVPGLLRAALLLLLLVTSCRQAAGAPVANELRCQCLQTLQRIHPKLIQSV EVTPPGASCDQTEVIATLKNGQKVCLNPEVPFVKKMIERMLDKDSSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccacgaccgccgccgttcaccgcgtccccggactcctccgggccgcgctg ctgctcctgctcctggtcacctcctgccggcaggctgcaggggcgcctgtggccaatgaa cttcgctgccagtgtttgcagaccttgcagagaattcaccccaagctcatccagagtgtg gaggtcacacccccaggagcctcctgtgaccaaactgaagtcatagccacgctcaagaac ggacagaaagtttgtctcaaccctgaagtcccttttgttaagaaaatgattgaaaggatg ctggacaaagatagctccaactaa

DBGET integrated database retrieval system